StarFunc result for job id P0CG23

User Input

>input (659 residues)
MLHQPTPGNRGLTARMEVGPATETFVLELQCLEDGGPGPDTLSGGSGGSESQEEEEPQER
NSSPQRPAVSAPVGASEIAEETRPGQRELQLQQLEQQPEPQQQPQHEQLQQPQPHLELQQ
QPQQDGQQQLSQLQQEKHQSVHHQELKPELQLMHQQQQLQPQQVQEQQRLQQQQEQLQTQ
QAQEQQVLQQQEQLQQQVQEQQLLQQQQEQLQQQQLLQQQEQLQQQQFQQQQEQLQQQQQ
LLLLQQQGQLQQQLLQQQQAQLQQQLLEQQQAQLQQQLLLQQQEQLQQQQQQQLLQQQQE
QLQQQQLQPPPLEPEEEEEVELELMPVDLGSEQELEQQRQELERQQELERQQEQRQLQLK
LQEELQQLEQQLEQQQQQLEQQEVQLELTPVELGAQQQEVQLELTPVQPELQLELVPAAG
GGGAAVPGAPAAVVVAPPGYVVVQELMVLPAVAAPAVVAIPGPAGSAALTPARQRRRRRA
RDRPTICGECGKGFSRSTDLVRHQATHTGERPHRCGECGKGFSQHSNLVTHQRIHTGEKP
YACSYCAKRFSESSALVQHQRTHTGERPYACGDCGKRFSVSSNLLRHRRTHSGERPYVCE
DCGERFRHKVQIRRHERQLHGAGRSRGLGLLRASRPAALGGPARAEQAATATAPADKAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H7X3	0.201	0.342	2.728E-19	374	0.150	0.265	Q9H7X3.pdb.gz	ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2
2	AFDB:Q9UJW8	0.216	0.206	8.749E-19	692	0.164	0.156	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
3	AFDB:Q8IWY8	0.218	0.170	1.118E-18	852	0.132	0.102	Q8IWY8.pdb.gz	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
4	AFDB:P10754	0.216	0.277	1.264E-18	512	0.135	0.174	P10754.pdb.gz	RHIT_MOUSE Transcriptional repressor Rhit OS=Mus musculus OX=10090 GN=Zfp13 PE=1 SV=2
5	AFDB:Q6PK81	0.209	0.304	1.344E-18	442	0.124	0.186	Q6PK81.pdb.gz	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
6	AFDB:P15620	0.193	0.219	1.826E-18	580	0.132	0.150	P15620.pdb.gz	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
7	AFDB:Q8BGV5	0.221	0.253	1.826E-18	572	0.138	0.159	Q8BGV5.pdb.gz	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
8	AFDB:Q6ZS27	0.195	0.290	2.334E-18	426	0.135	0.209	Q6ZS27.pdb.gz	ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens OX=9606 GN=ZNF662 PE=1 SV=1
9	AFDB:Q8TF45	0.211	0.205	2.806E-18	676	0.137	0.133	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
10	AFDB:P10073	0.217	0.289	3.372E-18	491	0.137	0.183	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
11	PDB:3w5kB	0.077	0.258	2.910E-4	110	0.056	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:2ja2A	0.052	0.065	1.297	485	0.030	0.041	2ja2A.pdb.gz
13	PDB:5gm6a	0.029	0.110	2.546	123	0.030	0.163	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:5c8dE	0.034	0.071	3.460	280	0.014	0.032	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
15	PDB:5xbtA	0.039	0.075	3.678	271	0.024	0.059	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
16	PDB:6ff4t	0.038	0.110	3.911	172	0.041	0.157	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:7dvqM	0.033	0.098	3.911	191	0.035	0.120	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:3efpB	0.080	0.164	5.651	208	0.020	0.062	3efpB.pdb.gz
19	PDB:6hivCb	0.057	0.100	6.008	252	0.041	0.107	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:7o4iW	0.051	0.082	6.008	312	0.030	0.064	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60304	4.28e-60	211	480	0.141	0.194	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
2	P17036	1.36e-51	186	446	0.120	0.177	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
3	Q86U76	2.88e-51	184	410	0.120	0.193	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
4	Q8NF99	9.93e-51	186	534	0.121	0.150	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
5	Q15937	2.70e-50	184	498	0.131	0.173	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
6	Q8IWY8	1.05e-49	188	852	0.117	0.090	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
7	Q6PF04	1.30e-49	185	617	0.121	0.130	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2
8	Q9P0L1	3.21e-49	186	754	0.126	0.110	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
9	Q9C0F3	4.09e-49	180	470	0.131	0.183	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
10	P17020	4.54e-49	184	682	0.118	0.114	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
11	Q6DD87	6.39e-49	177	382	0.123	0.212	ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4
12	O14771	6.91e-49	179	459	0.114	0.163	ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens OX=9606 GN=ZNF213 PE=1 SV=2
13	Q9ERU3	6.97e-49	173	237	0.114	0.316	ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus OX=10090 GN=Znf22 PE=1 SV=2
14	Q9BRR0	7.73e-49	181	538	0.123	0.151	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
15	Q9ERU2	1.24e-48	172	237	0.118	0.329	ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus OX=10116 GN=Znf22 PE=2 SV=2
16	P17029	1.84e-48	181	563	0.115	0.135	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
17	Q9NQV7	2.48e-48	184	894	0.126	0.093	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
18	Q9BRH9	3.13e-48	182	671	0.121	0.119	ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens OX=9606 GN=ZNF251 PE=1 SV=4
19	A0A0C4DG42	3.73e-48	179	539	0.117	0.143	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
20	Q8IZ26	4.10e-48	179	560	0.117	0.138	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	23	16.3	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00096 zf-C2H2	7.6e-22	87.6	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	7.6e-12	56.0	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	1.2e+02	14.1	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	2.6e+02	13.4	C2H2-type zinc ribbon
6	PF12171 zf-C2H2_jaz	3.1e-06	38.5	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	4.8e-24	94.9	Zinc-finger double domain
8	PF17772 zf-MYST	9.4e+02	10.9	MYST family zinc finger domain
9	PF18439 zf_UBZ	2.5	19.1	Ubiquitin-Binding Zinc Finger
10	PF17032 zinc_ribbon_15	23	17.1	zinc-ribbon family
11	PF09723 Zn-ribbon_8	48	15.5	Zinc ribbon domain
12	PF13408 Zn_ribbon_recom	2.4e+02	13.6	Recombinase zinc beta ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480322	0.713	CD99 antigen-like protein 2
2	9606.ENSP00000363043	0.691	Protein AAR2 homolog
3	9606.ENSP00000220062	0.557	Ras-like protein family member 12
4	9606.ENSP00000363023	0.556	Disks large-associated protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.879	organic cyclic compound binding
GO:1901363	0.878	heterocyclic compound binding
GO:0043565	0.618	sequence-specific DNA binding
GO:1990837	0.548	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0010468	0.974	regulation of gene expression
GO:0009889	0.820	regulation of biosynthetic process
GO:0019219	0.814	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.783	regulation of cellular biosynthetic process
GO:0009987	0.759	cellular process
GO:0010556	0.745	regulation of macromolecule biosynthetic process
GO:1903506	0.735	regulation of nucleic acid-templated transcription
GO:0006355	0.723	regulation of DNA-templated transcription
GO:0048523	0.323	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.979	nuclear lumen
GO:0005654	0.955	nucleoplasm
GO:0005737	0.912	cytoplasm
GO:0005829	0.482	cytosol
GO:0071944	0.447	cell periphery
GO:0005886	0.338	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]