StarFunc result for job id P0CG24

User Input

>input (379 residues)
MESEKIYMTANPYLCTECGKGYTCLASLTQHQKTHIGEKPYECKICGKSFTRNSNLVQHQ
RIHTGEKPYECNECGKAFSQSTNLIQHQRVHTGEKPYECNECEKTFSHRSSLRNHERIHT
GEKPYPCNECGKAFSHISALTQHHRIHTGKKPYECTECGKTFSRSTHLIEHQGIHSEEKS
YQCKQCRKVFCHSTSLIRHQRTHTGEKPYECNECGKAFSHTPAFIQHQRIHTGEKPYECN
ACGKAFNRSAHLTEHQRTHTGEKPYVCKECGKTFSRSTHLTEHLKIHSCVKPYQCNECQK
LFCYRTSLIRHQRTHTGEKPYQCNECGKSFSLSSALTKHKRIHTRERPYQCTKCGDVFCH
STSLIRHQKTHFRKETLAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CG24	1.000	1.000	2.224E-68	379	1.000	1.000	P0CG24.pdb.gz	ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens OX=9606 GN=ZNF883 PE=1 SV=1
2	AFDB:P52742	0.467	0.287	6.662E-48	658	0.591	0.340	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
3	AFDB:Q5TYW1	0.428	0.186	1.878E-46	1059	0.551	0.197	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
4	AFDB:Q14585	0.448	0.360	2.107E-46	488	0.580	0.451	Q14585.pdb.gz	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
5	AFDB:A0A0U1RQ46	0.510	0.330	2.504E-46	609	0.530	0.330	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
6	AFDB:Q6ZN57	0.446	0.377	2.977E-46	461	0.580	0.477	Q6ZN57.pdb.gz	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
7	AFDB:P17027	0.469	0.298	4.997E-46	643	0.551	0.325	P17027.pdb.gz	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
8	AFDB:Q9P0L1	0.428	0.239	4.997E-46	754	0.557	0.280	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
9	AFDB:P17020	0.453	0.281	5.293E-46	682	0.559	0.311	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
10	AFDB:Q5MCW4	0.456	0.272	5.607E-46	686	0.562	0.310	Q5MCW4.pdb.gz	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
11	PDB:3w5kB	0.117	0.273	3.654E-5	110	0.106	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4kblA	0.067	0.065	1.374E-1	395	0.084	0.081	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
13	PDB:5dkaA	0.070	0.224	2.588E-1	96	0.042	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:4r8pL	0.071	0.096	3.076E-1	254	0.050	0.075	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:5n5yI	0.043	0.150	4.876E-1	99	0.047	0.182	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
16	PDB:6ydhA	0.057	0.199	5.795E-1	62	0.032	0.194	6ydhA.pdb.gz
17	PDB:7oniH	0.070	0.070	6.502E-1	380	0.119	0.118	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:7nvw2	0.085	0.083	8.186E-1	390	0.092	0.090	7nvw2.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
19	PDB:8ap8d	0.094	0.112	8.186E-1	270	0.090	0.126	8ap8d.pdb.gz
20	PDB:7ena4	0.099	0.090	8.671E-1	457	0.079	0.066	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CG24	0.0	762	379	1.000	1.000	ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens OX=9606 GN=ZNF883 PE=1 SV=1
2	Q8TAQ5	1.12e-159	466	688	0.591	0.326	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
3	Q6ZN57	1.56e-159	457	461	0.580	0.477	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
4	P17020	2.83e-159	465	682	0.573	0.318	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
5	Q8BLA2	1.03e-158	460	578	0.588	0.386	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
6	Q7TMN8	1.13e-158	459	578	0.588	0.386	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
7	Q14585	2.41e-156	451	488	0.583	0.453	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
8	P52742	3.76e-156	456	658	0.607	0.350	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	Q9P0L1	9.03e-154	453	754	0.562	0.282	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
10	P51522	6.03e-153	443	516	0.554	0.407	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
11	Q9EQB9	3.08e-152	449	759	0.570	0.285	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
12	P15620	1.53e-151	441	580	0.551	0.360	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
13	Q5MCW4	6.22e-151	444	686	0.559	0.309	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
14	Q6ECI4	1.44e-150	444	717	0.567	0.300	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
15	P15622	8.90e-150	436	560	0.551	0.373	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
16	P17027	4.41e-149	437	643	0.557	0.328	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
17	Q8TBZ5	6.66e-149	434	544	0.562	0.392	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
18	Q5TYW1	5.67e-148	447	1059	0.554	0.198	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
19	Q6NX49	3.28e-147	435	715	0.546	0.290	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
20	Q8TF45	6.47e-147	433	676	0.536	0.300	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.25	22.9	TFIIH C1-like domain
2	PF10484 MRP-S23	1e+02	14.6	Mitochondrial ribosomal protein S23
3	PF01286 XPA_N	0.00017	32.8	XPA protein N-terminal
4	PF01428 zf-AN1	1.9e+02	13.6	AN1-like Zinc finger
5	PF00096 zf-C2H2	3.2e-68	233.7	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	4.9e-11	53.5	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	4.7e-40	143.8	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	8.1e-24	94.3	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	2e-11	55.1	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	3.4e-97	326.2	Zinc-finger double domain
11	PF12874 zf-met	0.017	26.7	Zinc-finger of C2H2 type
12	PF18439 zf_UBZ	3.3e-05	34.7	Ubiquitin-Binding Zinc Finger
13	PF17032 zinc_ribbon_15	0.00089	31.3	zinc-ribbon family
14	PF09723 Zn-ribbon_8	2.4e-08	45.2	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008961485.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.509	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.806	nucleic acid binding
GO:0003677	0.655	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.966	biological regulation
GO:0050789	0.907	regulation of biological process
GO:0009987	0.879	cellular process
GO:0019222	0.870	regulation of metabolic process
GO:0060255	0.861	regulation of macromolecule metabolic process
GO:0010468	0.820	regulation of gene expression
GO:0050794	0.818	regulation of cellular process
GO:0080090	0.788	regulation of primary metabolic process
GO:0051171	0.788	regulation of nitrogen compound metabolic process
GO:0031323	0.782	regulation of cellular metabolic process
GO:0032501	0.781	multicellular organismal process
GO:0009889	0.775	regulation of biosynthetic process
GO:2001141	0.769	regulation of RNA biosynthetic process
GO:0071840	0.761	cellular component organization or biogenesis
GO:0006355	0.750	regulation of DNA-templated transcription
GO:0016043	0.717	cellular component organization
GO:0006996	0.706	organelle organization
GO:0048523	0.500	negative regulation of cellular process
GO:0008152	0.493	metabolic process
GO:0050896	0.483	response to stimulus
GO:0006807	0.466	nitrogen compound metabolic process
GO:0050793	0.465	regulation of developmental process
GO:0045892	0.465	negative regulation of DNA-templated transcription
GO:0051716	0.431	cellular response to stimulus
GO:0051239	0.335	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.979	nucleoplasm
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0005737	0.488	cytoplasm
GO:0032991	0.482	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]