StarFunc result for job id P0CG37

User Input

>input (223 residues)
MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGE
VTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLL
LLPCALLHRLLRPDAPAHPRSLVPSVLQRERRPCGRPGLGHRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CG37	1.000	1.000	1.387E-39	223	1.000	1.000	P0CG37.pdb.gz	CFC1_HUMAN Cryptic protein OS=Homo sapiens OX=9606 GN=CFC1 PE=1 SV=1
2	AFDB:P97766	0.333	0.365	8.736E-19	202	0.444	0.490	P97766.pdb.gz	CFC1_MOUSE Cryptic protein OS=Mus musculus OX=10090 GN=Cfc1 PE=1 SV=1
3	AFDB:F1LV65	0.327	0.436	4.628E-16	164	0.386	0.524	F1LV65.pdb.gz	F1LV65_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=4
4	AFDB:P13385	0.196	0.221	2.052E-10	188	0.229	0.271	P13385.pdb.gz	TDGF1_HUMAN Protein Cripto OS=Homo sapiens OX=9606 GN=CRIPTO PE=1 SV=1
5	AFDB:P51865	0.225	0.277	5.836E-10	171	0.247	0.322	P51865.pdb.gz	TDGF1_MOUSE Teratocarcinoma-derived growth factor OS=Mus musculus OX=10090 GN=Cripto PE=1 SV=2
6	AFDB:F1Q691	0.294	0.343	4.423E-9	190	0.202	0.237	F1Q691.pdb.gz	F1Q691_DANRE Cryptic protein isoform 1 precursor OS=Danio rerio OX=7955 GN=cb85 PE=3 SV=1
7	AFDB:Q91649	0.204	0.231	1.634E-8	190	0.197	0.232	Q91649.pdb.gz	Q91649_XENLA Fibroblast growth factor receptor ligand 1 OS=Xenopus laevis OX=8355 GN=cripto1.3.L PE=2 SV=1
8	AFDB:Q6R8J2	0.135	0.043	4.818E-2	977	0.135	0.031	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
9	AFDB:O94769	0.139	0.059	6.679E-2	699	0.157	0.050	O94769.pdb.gz	ECM2_HUMAN Extracellular matrix protein 2 OS=Homo sapiens OX=9606 GN=ECM2 PE=2 SV=1
10	AFDB:O35550	0.142	0.040	2.311E-1	862	0.157	0.041	O35550.pdb.gz	RABE1_RAT Rab GTPase-binding effector protein 1 OS=Rattus norvegicus OX=10116 GN=Rabep1 PE=1 SV=1
11	PDB:7nycD	0.124	0.059	5.041E-1	487	0.058	0.027	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
12	PDB:6h03C	0.126	0.058	8.502E-1	513	0.076	0.033	6h03C.pdb.gz
13	PDB:7nydG	0.103	0.057	1.258	413	0.063	0.034	7nydG.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:5es4B	0.155	0.060	1.434	674	0.063	0.021	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
15	PDB:4e0sB	0.122	0.032	1.744	898	0.076	0.019	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:7nxdB	0.167	0.059	2.418	690	0.058	0.019	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
17	PDB:6o15A	0.108	0.073	3.141	355	0.040	0.025	6o15A.pdb.gz	On the structure and function of Escherichia coli YjhC: An oxidoreductase involved in bacterial sialic acid metabolism.
18	PDB:3t5oA	0.098	0.029	3.821	871	0.040	0.010	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
19	PDB:4g1eB	0.164	0.059	4.079	709	0.094	0.030	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
20	PDB:1z7qF	0.086	0.082	4.648	234	0.040	0.038	1z7qF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CG37	3.22e-163	451	223	1.000	1.000	CFC1_HUMAN Cryptic protein OS=Homo sapiens OX=9606 GN=CFC1 PE=1 SV=1
2	P97766	6.61e-53	171	202	0.417	0.460	CFC1_MOUSE Cryptic protein OS=Mus musculus OX=10090 GN=Cfc1 PE=1 SV=1
3	A0A8I6GC89	8.14e-53	171	201	0.417	0.463	A0A8I6GC89_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=1
4	F1LV65	1.88e-45	150	170	0.372	0.488	F1LV65_RAT Cripto, FRL-1, cryptic family 1 OS=Rattus norvegicus OX=10116 GN=Cfc1 PE=3 SV=4
5	A7MCB2	1.07e-27	105	183	0.229	0.279	A7MCB2_DANRE Cryptic protein isoform 2 precursor OS=Danio rerio OX=7955 GN=oep PE=2 SV=1
6	F1Q691	1.34e-25	100	190	0.242	0.284	F1Q691_DANRE Cryptic protein isoform 1 precursor OS=Danio rerio OX=7955 GN=cb85 PE=3 SV=1
7	P51865	4.39e-23	93.6	171	0.233	0.304	TDGF1_MOUSE Teratocarcinoma-derived growth factor OS=Mus musculus OX=10090 GN=Cripto PE=1 SV=2
8	Q91649	3.92e-21	89.0	190	0.188	0.221	Q91649_XENLA Fibroblast growth factor receptor ligand 1 OS=Xenopus laevis OX=8355 GN=cripto1.3.L PE=2 SV=1
9	P13385	1.41e-18	82.0	188	0.161	0.191	TDGF1_HUMAN Protein Cripto OS=Homo sapiens OX=9606 GN=CRIPTO PE=1 SV=1
10	P51864	1.86e-17	79.0	188	0.157	0.186	TDGF3_HUMAN Putative protein CRIPTO3 OS=Homo sapiens OX=9606 GN=CRIPTO3 PE=5 SV=1
11	Q2PZL6	4.45e-05	46.2	4981	0.112	0.005	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
12	Q95RQ1	2.78e-04	43.5	512	0.135	0.059	Q95RQ1_DROME LD16414p OS=Drosophila melanogaster OX=7227 GN=slow PE=2 SV=1
13	A8DZ86	0.001	41.6	688	0.081	0.026	A8DZ86_DANRE Vasorin a OS=Danio rerio OX=7955 GN=id:ibd2098 PE=1 SV=1
14	P46531	0.001	41.6	2555	0.112	0.010	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
15	Q20531	0.001	42.0	3514	0.161	0.010	Q20531_CAEEL C-type LECtin OS=Caenorhabditis elegans OX=6239 GN=clec-78 PE=1 SV=2
16	Q6V0I7	0.001	42.0	4981	0.103	0.005	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
17	Q14517	0.002	41.2	4588	0.108	0.005	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
18	Q75ZI3	0.002	41.2	1570	0.099	0.014	Q75ZI3_DANRE Dermacan OS=Danio rerio OX=7955 GN=dcan PE=1 SV=1
19	Q92832	0.002	41.2	810	0.103	0.028	NELL1_HUMAN Protein kinase C-binding protein NELL1 OS=Homo sapiens OX=9606 GN=NELL1 PE=1 SV=4
20	D2XV92	0.003	40.4	1513	0.130	0.019	D2XV92_CHICK SLIT1 (Fragment) OS=Gallus gallus OX=9031 GN=SLIT1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09443 CFC	2.4e-12	57.8	Cripto_Frl-1_Cryptic (CFC)
2	PF00008 EGF	26	16.5	EGF-like domain
3	PF07974 EGF_2	1.8	20.3	EGF-like domain
4	PF12661 hEGF	11	18.0	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262160	0.934	Mothers against decapentaplegic homolog 2
2	9606.ENSP00000323155	0.926	DAN domain family member 5
3	9606.ENSP00000287139	0.921	Nodal homolog
4	9606.ENSP00000332973	0.918	Mothers against decapentaplegic homolog 3
5	9606.ENSP00000370297	0.910	Cerberus
6	9606.ENSP00000355785	0.891	Left-right determination factor 2
7	9606.ENSP00000340361	0.885	Activin receptor type-2B
8	9606.ENSP00000442656	0.873	Activin receptor type-1B
9	9606.ENSP00000272134	0.869	Left-right determination factor 1
10	9606.ENSP00000329219	0.815	Formin-like protein 1
11	9606.ENSP00000386773	0.805	Uncharacterized protein
12	9606.ENSP00000281928	0.764	Mediator of RNA polymerase II transcription subunit 13-like
13	9606.ENSP00000241416	0.760	Activin receptor type-2A
14	9606.ENSP00000320089	0.744	Homeobox protein Nkx-2.6
15	9606.ENSP00000243349	0.743	Activin receptor type-1C
16	9606.ENSP00000247005	0.742	Growth differentiation factor 1
17	9606.ENSP00000366534	0.730	Forkhead box protein H1
18	9606.ENSP00000287538	0.715	Zinc finger protein ZIC 3
19	9606.ENSP00000341551	0.706	Mothers against decapentaplegic homolog 4
20	9606.ENSP00000485582	0.655	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038100	0.532	nodal binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007167	0.991	enzyme-linked receptor protein signaling pathway
GO:0007178	0.980	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032924	0.944	activin receptor signaling pathway
GO:0032501	0.785	multicellular organismal process
GO:0048856	0.747	anatomical structure development
GO:0007275	0.714	multicellular organism development
GO:0048518	0.627	positive regulation of biological process
GO:0019222	0.452	regulation of metabolic process
GO:0060255	0.421	regulation of macromolecule metabolic process
GO:0048731	0.371	system development
GO:0048522	0.347	positive regulation of cellular process
GO:0038092	0.324	nodal signaling pathway
GO:0048583	0.314	regulation of response to stimulus
GO:0048513	0.305	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.434	protein-containing complex
GO:0005576	0.350	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]