StarFunc result for job id P0CG38

User Input

>input (1075 residues)
MVAEVDSMPAASSVKKPFVLRSKMGKWCRHCFPCCRGSGKSNVGTSGDQDDSTMKTLRSK
MGKWCCHCFPCCRGSGKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSNVGAW
GDYDDSAFVEPRYHVRREDLDKLHRAAWWGKVARKDLIVMLRDTDVNKQDKQKRTALHLA
SANGNSGVVKLLLDRRCQLNVLDNKKRTALTKAVQCQEDECALMLLEHGTDPNIPDEYGN
TTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHHVICQLLSDY
KEKQMLKISSENSNPEQDLKLTSEEESQRFKGSENSQPEKMSQEPEINKDGDREVEEEMK
KHESNNVGLLENLSNGVTAGNGDDGLIPQRKSRTPENQQFPDNESEEYHRICELVSDYKE
KQMPKYSSENSNPEQDLKLTSEEESQRLKGSENGQPEKRSQEPEINKDGDRELENFMAIE
EMKKHGSTHVGFPENLTNGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQ
KQFCEEQNTGILHDEILIHEEKQIEVVEKMNSELSLSCKKEKDFLHENSTLREEIAMLRL
ELDTMKHQSQLRKKKYLEDIESVKKKNDNLLKALQLNELTMDDDTAVLVIDNGSGMCKAG
FAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWD
DMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAML
SLYTSGRTTGIVMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELTDYLMKILTERGYRF
TTMAEREIVRDIKEKLCYVALDFEQEMAMAASSSSLEKSYELPDGQVITIGNEWFRCPEA
LFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYTNTVLSGGTTMYPGMAHRMQKEIAAL
APSMLKIRIIAPPKRKYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5A3E0	0.435	0.435	0.000	1075	0.967	0.967	A5A3E0.pdb.gz	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
2	AFDB:P07829	0.347	0.992	2.710E-59	376	0.296	0.846	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
3	AFDB:B6VNT8	0.347	0.989	2.561E-58	377	0.302	0.862	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
4	AFDB:P10989	0.348	0.993	2.659E-57	375	0.292	0.837	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
5	AFDB:P0CJ46	0.346	0.985	1.305E-56	377	0.286	0.814	P0CJ46.pdb.gz	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
6	AFDB:Q562R1	0.347	0.990	1.898E-56	376	0.294	0.840	Q562R1.pdb.gz	ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2
7	AFDB:A0A1D8PFR4	0.346	0.987	2.163E-55	376	0.278	0.795	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
8	AFDB:P86287	0.347	0.989	4.574E-55	376	0.265	0.758	P86287.pdb.gz	ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=ACT1 PE=1 SV=1
9	PDB:1c0gA	0.337	0.974	4.919E-55	368	0.297	0.867	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
10	AFDB:Q8RYC2	0.346	0.981	8.020E-55	378	0.259	0.735	Q8RYC2.pdb.gz	ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana OX=3702 GN=ACT5 PE=5 SV=1
11	AFDB:P07828	0.345	0.972	1.862E-54	380	0.269	0.761	P07828.pdb.gz	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
12	PDB:1yagA	0.341	0.976	4.234E-54	372	0.287	0.828	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
13	PDB:6tu4A	0.341	0.967	1.614E-51	372	0.265	0.766	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:4cbxA	0.330	0.985	9.287E-48	358	0.236	0.709	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
15	PDB:4pl7A	0.320	0.895	6.037E-47	382	0.256	0.720	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
16	PDB:4a7fA	0.336	0.927	7.485E-45	375	0.300	0.861	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
17	PDB:6ltjK	0.292	0.974	3.102E-36	317	0.272	0.921	6ltjK.pdb.gz	Structure of nucleosome-bound human BAF complex.
18	PDB:7nvmK	0.265	0.837	3.250E-36	317	0.268	0.909	7nvmK.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
19	PDB:5kg8B	0.285	0.953	2.193E-34	313	0.250	0.859	5kg8B.pdb.gz
20	PDB:6w18B	0.314	0.893	9.530E-31	367	0.158	0.463	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PFR4	657	376	0.278	0.795	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
2	A0JP26	892	581	0.405	0.749	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
3	A5A3E0	2172	1075	0.967	0.967	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
4	B6VNT8	696	377	0.302	0.862	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
5	F1P476	696	377	0.301	0.859	F1P476_CHICK Actin, alpha 2, smooth muscle, aorta OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
6	F1RCB6	685	377	0.295	0.841	F1RCB6_DANRE Actin alpha cardiac muscle 1a OS=Danio rerio OX=7955 GN=zgc:86725 PE=1 SV=1
7	G1NS52	724	376	0.314	0.899	G1NS52_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 GN=LOC100542800 PE=3 SV=1
8	G3CKA6	708	376	0.306	0.875	G3CKA6_SPOFR Actin OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
9	O45815	667	375	0.298	0.853	O45815_CAEEL Actin OS=Caenorhabditis elegans OX=6239 GN=act-5 PE=1 SV=1
10	P02572	718	376	0.310	0.886	ACT2_DROME Actin-42A OS=Drosophila melanogaster OX=7227 GN=Act42A PE=1 SV=3
11	P07828	631	380	0.269	0.761	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
12	P07829	690	376	0.296	0.846	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
13	P07830	697	376	0.302	0.864	ACT1_DICDI Major actin OS=Dictyostelium discoideum OX=44689 GN=act1 PE=1 SV=2
14	P08023	695	377	0.300	0.857	ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
15	P0CG38	2254	1075	1.000	1.000	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
16	P0CG39	2136	1038	0.957	0.991	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
17	P0CJ46	665	377	0.286	0.814	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
18	P0CJ47	665	377	0.286	0.814	ACT3_ARATH Actin-3 OS=Arabidopsis thaliana OX=3702 GN=ACT3 PE=1 SV=1
19	P0DM41	717	376	0.309	0.883	ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans OX=6239 GN=act-1 PE=1 SV=1
20	P0DM42	717	376	0.309	0.883	ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans OX=6239 GN=act-3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	3e-137	469.0	Actin
2	PF00023 Ank	1.2e-20	84.2	Ankyrin repeat
3	PF12796 Ank_2	6e-29	111.8	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	2.5e-14	62.8	Ankyrin repeat
5	PF13637 Ank_4	2.4e-22	90.3	Ankyrin repeats (many copies)
6	PF13857 Ank_5	9.2e-24	94.5	Ankyrin repeats (many copies)
7	PF14915 CCDC144C	2.3e-09	48.4	CCDC144C protein coiled-coil region
8	PF18579 Raf1_HTH	5.9e+02	11.6	Rubisco accumulation factor 1 helix turn helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392718

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348128	0.777	Supervillin
2	9606.ENSP00000414906	0.610	Dynactin subunit 4
3	9606.ENSP00000338013	0.604	Coiled-coil domain containing 183
4	9606.ENSP00000318297	0.599	RuvB-like 1
5	9606.ENSP00000457991	0.596	PH domain leucine-rich repeat-containing protein phosphatase 2
6	9606.ENSP00000221462	0.595	Protein phosphatase 1 regulatory subunit 37
7	9606.ENSP00000379451	0.587	Zinc finger protein 418
8	9606.ENSP00000367494	0.577	Protein spire homolog 2
9	9606.ENSP00000361883	0.573	Adenylyl cyclase-associated protein 1
10	9606.ENSP00000336842	0.570	Actin-related protein 8
11	9606.ENSP00000392206	0.567	ArfGAP with GTPase domain, ankyrin repeat and PH domain 10
12	9606.ENSP00000392513	0.567	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4
13	9606.ENSP00000417653	0.557	Drebrin-like protein
14	9606.ENSP00000229922	0.555	Adenylyl cyclase-associated protein 2
15	9606.ENSP00000427687	0.545	WD repeat-containing protein 1
16	9606.ENSP00000381198	0.544	LisH domain and HEAT repeat-containing protein KIAA1468
17	9606.ENSP00000355205	0.538	DNA helicase INO80
18	9606.ENSP00000352925	0.529	Transformation/transcription domain-associated protein
19	9606.ENSP00000336831	0.521	Plastin-1
20	9606.ENSP00000401010	0.519	F-actin-capping protein subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.416	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0001895	0.992	retina homeostasis
GO:0009987	0.511	cellular process
GO:0065007	0.349	biological regulation
GO:0050789	0.338	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	1.000	extracellular exosome
GO:0005622	0.716	intracellular anatomical structure
GO:0043229	0.662	intracellular organelle
GO:0005737	0.425	cytoplasm
GO:0072562	0.334	blood microparticle
GO:0043232	0.302	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]