StarFunc result for job id P0CI01

User Input

>input (402 residues)
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSSILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKRWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKHRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CI01	1.000	1.000	1.041E-60	402	1.000	1.000	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	AFDB:P0DTA3	0.401	0.598	1.621E-27	265	0.557	0.845	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
3	AFDB:A6NLX3	0.377	0.627	1.081E-21	237	0.415	0.705	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
4	AFDB:Q9NRI5	0.093	0.048	2.350E-1	854	0.184	0.087	Q9NRI5.pdb.gz	DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=3
5	AFDB:B0S7D7	0.089	0.058	3.441E-1	727	0.154	0.085	B0S7D7.pdb.gz
6	AFDB:Q0WVU3	0.089	0.093	6.268E-1	375	0.127	0.136	Q0WVU3.pdb.gz	PHL5_ARATH Myb family transcription factor PHL5 OS=Arabidopsis thaliana OX=3702 GN=PHL5 PE=2 SV=1
7	AFDB:M9NDQ8	0.096	0.078	6.990E-1	530	0.132	0.100	M9NDQ8.pdb.gz	M9NDQ8_DROME Nuclear fallout, isoform G OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
8	AFDB:P12755	0.073	0.048	6.990E-1	728	0.147	0.081	P12755.pdb.gz	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
9	PDB:7kpvB	0.123	0.161	7.686E-1	290	0.045	0.062	7kpvB.pdb.gz
10	AFDB:A4IJ58	0.077	0.044	7.796E-1	831	0.102	0.049	A4IJ58.pdb.gz	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
11	AFDB:Q22695	0.131	0.144	7.796E-1	356	0.107	0.121	Q22695.pdb.gz	CD5R1_CAEEL Cyclin-dependent kinase 5 activator 1 OS=Caenorhabditis elegans OX=6239 GN=cdka-1 PE=2 SV=2
12	PDB:3hajA	0.080	0.106	1.741	286	0.095	0.133	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
13	PDB:2w8qA	0.069	0.059	2.550	485	0.040	0.033	2w8qA.pdb.gz	Redox-Switch Modulation of Human Ssadh by Dynamic Catalytic Loop.
14	PDB:1g3nC	0.119	0.187	3.171	233	0.045	0.077	1g3nC.pdb.gz
15	PDB:1sqfA	0.128	0.122	3.349	425	0.022	0.021	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
16	PDB:2w96A	0.150	0.229	3.349	249	0.027	0.044	2w96A.pdb.gz
17	PDB:5iy6U	0.069	0.130	3.349	170	0.052	0.124	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
18	PDB:6kvgA	0.129	0.193	3.349	256	0.027	0.043	6kvgA.pdb.gz
19	PDB:3g33B	0.128	0.200	3.537	229	0.087	0.153	3g33B.pdb.gz
20	PDB:6jt0A	0.071	0.056	3.735	542	0.022	0.017	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CI01	0.0	823	402	1.000	1.000	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	Q495Y8	0.0	815	402	0.993	0.993	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
3	P0DTA3	2.76e-117	343	265	0.460	0.698	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	A6NLX3	2.43e-67	215	237	0.303	0.515	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	6.52e-59	194	268	0.254	0.381	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9PU13	2.13e-18	87.0	299	0.139	0.187	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q9YGL1	2.23e-17	84.3	298	0.112	0.151	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
8	Q5MJ68	5.46e-16	80.1	293	0.102	0.140	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q4R1K5	6.72e-13	71.2	311	0.119	0.154	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
10	A0A384MTT5	9.29e-13	70.9	313	0.117	0.150	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
11	Q5MJ70	9.29e-13	70.9	313	0.117	0.150	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
12	Q5IBH7	9.30e-13	70.9	310	0.139	0.181	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
13	Q6WRI0	0.30	36.2	2623	0.057	0.009	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
14	Q961D9	2.4	33.1	1469	0.052	0.014	BCL9_DROME Protein BCL9 homolog OS=Drosophila melanogaster OX=7227 GN=lgs PE=1 SV=1
15	Q9NYB0	6.5	31.2	399	0.157	0.158	TE2IP_HUMAN Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	5.1e-51	183.8	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485230

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.800	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.800	Cyclin-dependent kinase 1
3	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.405	enzyme binding
GO:0019901	0.396	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.993	positive regulation of biological process
GO:0080090	0.990	regulation of primary metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0048522	0.981	positive regulation of cellular process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0051726	0.970	regulation of cell cycle
GO:0051246	0.909	regulation of protein metabolic process
GO:0009987	0.875	cellular process
GO:0009893	0.789	positive regulation of metabolic process
GO:0045859	0.775	regulation of protein kinase activity
GO:0031325	0.764	positive regulation of cellular metabolic process
GO:0022414	0.722	reproductive process
GO:1904029	0.712	regulation of cyclin-dependent protein kinase activity
GO:0071704	0.694	organic substance metabolic process
GO:0043170	0.626	macromolecule metabolic process
GO:0022402	0.578	cell cycle process
GO:0045787	0.524	positive regulation of cell cycle
GO:0006807	0.511	nitrogen compound metabolic process
GO:0044238	0.499	primary metabolic process
GO:0044237	0.492	cellular metabolic process
GO:0006996	0.488	organelle organization
GO:0090304	0.458	nucleic acid metabolic process
GO:0050896	0.434	response to stimulus
GO:0051173	0.432	positive regulation of nitrogen compound metabolic process
GO:0010604	0.421	positive regulation of macromolecule metabolic process
GO:0051716	0.403	cellular response to stimulus
GO:0033554	0.389	cellular response to stress
GO:0071900	0.350	regulation of protein serine/threonine kinase activity
GO:0033043	0.345	regulation of organelle organization
GO:0010564	0.344	regulation of cell cycle process
GO:0000079	0.338	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0048519	0.336	negative regulation of biological process
GO:1901564	0.336	organonitrogen compound metabolic process
GO:0006974	0.326	cellular response to DNA damage stimulus
GO:0044260	0.305	cellular macromolecule metabolic process
GO:0019538	0.305	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005654	0.987	nucleoplasm
GO:0005737	0.957	cytoplasm
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0005829	0.873	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]