StarFunc result for job id P0CJ78

User Input

>input (1059 residues)
MEANPAGSGAGGGGSSGIGGEDGVHFQSYPFDFLEFLNHQRFEPMELYGEHAKAVAALPC
APGPPPQPPPQPPPPQYDYPPQSTFKPKAEVPSSSSSSSSSSSSSSSSSSSSSSSSSQAK
KPDPPLPPAFGAPPPPLFDAAFPTPQWGIVDLSGHQHLFGNLKRGGPASGPGVTPGLGAP
AGAPGPLPAPSQTPPGPPAAAACDPTKDDKGYFRRLKYLMERRFPCGVCQKSFKQSSHLV
QHMLVHSGERPYECGVCGRTYNHVSSLIRHRRCHKDVPPAAGGPPQPGPHLPPLGLPAPA
ASAATAAAPSTVSSGPPATPVAPAPSADGSAAPAGVGVPPPATGGGDGPFACPLCWKVFK
KPSHLHQHQIIHTGEKPFSCSVCSKSFNRRESLKRHVKTHSADLLRLPCGICGKAFRDAS
YLLKHQAAHAGAGAGGPRPVYPCDLCGKSYSAPQSLLRHKAAHAPPAAAAEAPKDGAASA
PQPPPTFPPGPYLLPPDPPTTDSEKAAAAAAAVVYGAVPVPLLGAHPLLLGGAGTSGAGG
SGASVPGKTFCCGICGRGFGRRETLKRHERIHTGEKPHQCPVCGKRFRESFHLSKHHVVH
TRERPYKCELCGKVFGYPQSLTRHRQVHRLQLPCALAGAAGLPSTQGTPGACGPGASGTS
AGPTDGLSYACSDCGEHFPDLFHVMSHKEVHMAEKPYGCDACGKTFGFIENLMWHKLVHQ
AAPERLLPPAPGGLQPPDGSSGTDAASVLDNGLAGEVGAAVAALAGVSGGEDAGGAAVAG
AGGGASSGPERFSCATCGQSFKHFLGLVTHKYVHLVRRTLGCGLCGQSFAGAYDLLLHRR
SHRQKRGFRCPVCGKRFWEAALLMRHQRCHTEQRPYRCGVCGRGFLRSWYLRQHRVVHTG
ERAFKCGVCAKRFAQSSSLAEHRRLHAVARPQRCSACGKTFRYRSNLLEHQRLHLGERAY
RCEHCGKGFFYLSSVLRHQRAHEPPRPELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCS
SCGEGFANTYGLKKHRLAHKAENLGGPGAGAGTLAGKDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PEP7	0.161	0.208	4.695E-24	755	0.152	0.213	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
2	AFDB:A0A024RC04	0.144	0.179	1.138E-23	805	0.154	0.202	A0A024RC04.pdb.gz
3	AFDB:M9PG92	0.158	0.201	1.930E-21	794	0.159	0.212	M9PG92.pdb.gz	M9PG92_DROME Jim, isoform G OS=Drosophila melanogaster OX=7227 GN=jim PE=4 SV=1
4	AFDB:F1QI36	0.099	0.083	5.899E-18	1313	0.191	0.154	F1QI36.pdb.gz	F1QI36_DANRE Sal-like protein 1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
5	AFDB:Q9HCE3	0.072	0.062	2.158E-16	1301	0.170	0.138	Q9HCE3.pdb.gz	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
6	AFDB:Q92766	0.084	0.056	8.882E-15	1687	0.164	0.103	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
7	AFDB:A0MWC1	0.105	0.102	1.264E-13	1091	0.180	0.175	A0MWC1.pdb.gz	A0MWC1_DANRE Sal-like protein 4 OS=Danio rerio OX=7955 GN=sb:cb372 PE=1 SV=1
8	AFDB:Q8BX22	0.074	0.073	7.422E-13	1067	0.194	0.192	Q8BX22.pdb.gz	SALL4_MOUSE Sal-like protein 4 OS=Mus musculus OX=10090 GN=Sall4 PE=1 SV=2
9	AFDB:Q7Z4V0	0.089	0.109	3.055E-11	828	0.127	0.163	Q7Z4V0.pdb.gz	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
10	AFDB:M9NEG1	0.079	0.075	6.570E-10	1109	0.106	0.101	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
11	PDB:3w5kB	0.056	0.317	5.382E-4	110	0.038	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4z4kA	0.037	0.105	1.225	282	0.018	0.067	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
13	PDB:5dkaA	0.025	0.168	1.378	96	0.016	0.177	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:6o9lQ	0.028	0.055	1.462	430	0.043	0.107	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:5xbtA	0.033	0.092	1.745	271	0.019	0.074	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
16	PDB:4wlwA	0.035	0.177	1.851	130	0.016	0.131	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
17	PDB:5gm6a	0.022	0.118	3.758	123	0.010	0.089	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:6r5kO	0.036	0.065	4.485	447	0.016	0.038	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
19	PDB:7vo0G	0.027	0.154	4.485	131	0.025	0.198	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
20	PDB:5c8dE	0.027	0.077	5.047	280	0.011	0.043	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05481	9.77e-116	387	1191	0.241	0.214	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
2	Q6ZR52	4.87e-93	312	646	0.191	0.313	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
3	Q5DTF8	6.26e-93	319	919	0.238	0.274	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
4	Q3V1X2	4.34e-92	316	888	0.240	0.286	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
5	Q7TPL6	5.57e-92	316	888	0.240	0.286	Q7TPL6_MOUSE Zinc finger protein 748 OS=Mus musculus OX=10090 GN=Zfp748 PE=1 SV=1
6	Q96JF6	1.66e-91	312	807	0.200	0.263	ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens OX=9606 GN=ZNF594 PE=2 SV=3
7	P17038	2.23e-91	312	809	0.198	0.260	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
8	Q9UII5	2.46e-87	300	783	0.205	0.277	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
9	Q86WZ6	9.44e-87	299	799	0.166	0.220	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
10	Q9P2J8	3.59e-86	299	865	0.181	0.222	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
11	Q14587	1.02e-84	296	947	0.195	0.219	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
12	A0A8I6G8Y2	9.09e-83	286	723	0.156	0.228	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
13	G3V9G6	1.11e-82	286	740	0.156	0.223	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
14	Q8TAQ5	1.28e-82	285	688	0.181	0.279	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
15	Q62788	1.69e-82	286	744	0.156	0.222	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
16	P17021	1.97e-82	283	662	0.161	0.257	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
17	Q8IYB9	7.85e-82	281	648	0.151	0.247	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
18	Q7TMN8	1.21e-81	279	578	0.159	0.291	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
19	Q8BLA2	1.29e-81	279	578	0.159	0.291	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
20	Q9UJW7	3.98e-81	284	825	0.167	0.215	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	3.4e+02	12.6	Rad4 beta-hairpin domain 1
2	PF01722 BolA	0.048	25.3	BolA-like protein
3	PF19126 DUF5810	0.5	21.9	Family of unknown function (DUF5810)
4	PF00096 zf-C2H2	6.1e-70	239.1	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	4.7e+02	12.0	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	5.6e-47	165.3	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	1.1e-17	74.8	C2H2-type zinc finger
8	PF15909 zf-C2H2_8	1.3e+02	14.3	C2H2-type zinc ribbon
9	PF12171 zf-C2H2_jaz	4.2e-18	76.4	Zinc-finger double-stranded RNA-binding
10	PF13913 zf-C2HC_2	7.9e+02	11.4	zinc-finger of a C2HC-type
11	PF05605 zf-Di19	5.7	18.6	Drought induced 19 protein (Di19), zinc-binding
12	PF13465 zf-H2C2_2	5.7e-64	221.1	Zinc-finger double domain
13	PF12874 zf-met	4.9e-13	60.2	Zinc-finger of C2H2 type
14	PF09723 Zn-ribbon_8	7.6	18.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262577	0.554	Zinc finger CCCH domain-containing protein 3
2	9606.ENSP00000221573	0.552	snRNA-activating protein complex subunit 2
3	9606.ENSP00000293879	0.527	WD repeat-containing protein 90

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.957	transcription regulator activity
GO:0003700	0.952	DNA-binding transcription factor activity
GO:0003676	0.915	nucleic acid binding
GO:0003677	0.855	DNA binding
GO:0043565	0.705	sequence-specific DNA binding
GO:1990837	0.610	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.997	regulation of metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0051252	0.966	regulation of RNA metabolic process
GO:1903506	0.949	regulation of nucleic acid-templated transcription
GO:0010468	0.946	regulation of gene expression
GO:0009987	0.870	cellular process
GO:0006355	0.834	regulation of DNA-templated transcription
GO:0048519	0.578	negative regulation of biological process
GO:0048523	0.543	negative regulation of cellular process
GO:0051172	0.498	negative regulation of nitrogen compound metabolic process
GO:0010605	0.495	negative regulation of macromolecule metabolic process
GO:0031324	0.453	negative regulation of cellular metabolic process
GO:1903507	0.396	negative regulation of nucleic acid-templated transcription
GO:0071704	0.395	organic substance metabolic process
GO:0048518	0.334	positive regulation of biological process
GO:0045892	0.332	negative regulation of DNA-templated transcription
GO:0044237	0.323	cellular metabolic process
GO:0048522	0.309	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.982	nucleoplasm
GO:0005737	0.669	cytoplasm
GO:0043232	0.440	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]