StarFunc result for job id P0CJ88

User Input

>input (424 residues)
MALPTPSDSTLPAEARGRGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPE
PRVQIWFQNERSRQLRQHRRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPG
IAAREELARETGLPESRIQIWFQNRRARHPGQGGRAPAQAGGLCSAAPGGGHPAPSWVAF
AHTGAWGTGLPAPHVPCAPGALPQGAFVSQAARAAPALQPSQAAPAEGVSQPAPARGDFA
YAAPAPPDGALSHPQAPRWPPHPGKSREDRDPQRDGLPGPCAVAQPGPAQAGPQGQGVLA
PPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASASARQGQMQGIPAPSQALQ
EPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRAL
LEEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C3U3A0	0.353	0.353	9.615E-54	424	0.998	0.998	C3U3A0.pdb.gz	C3U3A0_HUMAN DUX4 OS=Homo sapiens OX=9606 GN=DUX4 PE=2 SV=1
2	AFDB:A6NJT0	0.163	0.131	1.268E-6	531	0.267	0.213	A6NJT0.pdb.gz	UNC4_HUMAN Homeobox protein unc-4 homolog OS=Homo sapiens OX=9606 GN=UNCX PE=3 SV=1
3	AFDB:P25425	0.136	0.084	1.271E-5	770	0.167	0.092	P25425.pdb.gz	PO2F1_MOUSE POU domain, class 2, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou2f1 PE=1 SV=3
4	AFDB:O08934	0.155	0.125	4.541E-5	530	0.252	0.202	O08934.pdb.gz	UNC4_MOUSE Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2
5	AFDB:O18381	0.123	0.061	1.353E-4	857	0.186	0.092	O18381.pdb.gz	PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster OX=7227 GN=ey PE=1 SV=3
6	AFDB:Q9C0A1	0.143	0.028	4.031E-4	2572	0.257	0.042	Q9C0A1.pdb.gz	ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=3
7	AFDB:P22810	0.143	0.119	1.001E-3	542	0.208	0.162	P22810.pdb.gz	HMOC_DROME Homeotic protein ocelliless OS=Drosophila melanogaster OX=7227 GN=oc PE=2 SV=2
8	AFDB:P81067	0.149	0.127	2.073E-3	507	0.219	0.183	P81067.pdb.gz	IRX3_MOUSE Iroquois-class homeodomain protein IRX-3 OS=Mus musculus OX=10090 GN=Irx3 PE=1 SV=2
9	AFDB:Q2MHN3	0.144	0.025	2.642E-3	2562	0.196	0.032	Q2MHN3.pdb.gz	ZFHX2_MOUSE Zinc finger homeobox protein 2 OS=Mus musculus OX=10090 GN=Zfhx2 PE=1 SV=1
10	AFDB:Q9UIU6	0.123	0.078	3.801E-3	781	0.186	0.101	Q9UIU6.pdb.gz	SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2
11	PDB:4egcA	0.108	0.085	3.003E-2	539	0.052	0.041	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.117	0.575	1.073E-1	73	0.040	0.233	2hi3A.pdb.gz
13	PDB:7fbyA	0.093	0.231	1.968E-1	153	0.026	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:6lthO	0.090	0.116	3.609E-1	325	0.071	0.092	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
15	PDB:5l3cB	0.101	0.294	3.835E-1	134	0.045	0.142	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
16	PDB:2cg4A	0.107	0.276	4.075E-1	149	0.024	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:2vbwA	0.107	0.279	5.518E-1	147	0.035	0.102	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
18	PDB:7vdvX	0.085	0.137	6.619E-1	252	0.071	0.119	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
19	PDB:4czzB	0.100	0.293	1.012	133	0.040	0.128	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
20	PDB:5nr5A	0.117	0.370	1.143	113	0.017	0.062	5nr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C3U3A0	0.0	806	424	0.998	0.998	C3U3A0_HUMAN DUX4 OS=Homo sapiens OX=9606 GN=DUX4 PE=2 SV=1
2	Q6RFH8	0.0	610	374	0.830	0.941	DUX4C_HUMAN Double homeobox protein 4C OS=Homo sapiens OX=9606 GN=DUX4L9 PE=1 SV=1
3	Q9UBX2	0.0	806	424	0.998	0.998	DUX4_HUMAN Double homeobox protein 4 OS=Homo sapiens OX=9606 GN=DUX4 PE=1 SV=2
4	O43812	1.27e-89	270	170	0.328	0.818	DUX1_HUMAN Double homeobox protein 1 OS=Homo sapiens OX=9606 GN=DUX1 PE=1 SV=1
5	L7MUF5	1.43e-36	134	189	0.165	0.370	L7MUF5_MOUSE Double homeobox B-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Duxbl1 PE=4 SV=1
6	Q7TNE6	1.60e-35	136	350	0.196	0.237	Q7TNE6_MOUSE Double homeobox B-like OS=Mus musculus OX=10090 GN=Duxbl1 PE=1 SV=1
7	A6NLW8	3.94e-31	120	204	0.165	0.343	DUXA_HUMAN Double homeobox protein A OS=Homo sapiens OX=9606 GN=DUXA PE=2 SV=1
8	Q3UY88	4.17e-27	109	201	0.137	0.289	Q3UY88_MOUSE Double homeobox B-like 1 OS=Mus musculus OX=10090 GN=Duxbl1 PE=2 SV=1
9	A0JPE5	8.48e-15	77.0	309	0.085	0.117	A0JPE5_DANRE Mix-type homeobox gene 1 OS=Danio rerio OX=7955 GN=mtx1 PE=2 SV=1
10	Q1RM27	9.53e-15	76.6	296	0.075	0.108	Q1RM27_DANRE Mix-type homeobox gene 2 OS=Danio rerio OX=7955 GN=mtx2 PE=2 SV=1
11	P21711	4.24e-14	75.5	377	0.092	0.103	MIX1_XENLA Homeobox protein Mix.1 OS=Xenopus laevis OX=8355 GN=mix-a PE=2 SV=2
12	Q9UBX0	4.15e-13	69.7	185	0.075	0.173	HESX1_HUMAN Homeobox expressed in ES cells 1 OS=Homo sapiens OX=9606 GN=HESX1 PE=1 SV=1
13	O42357	1.44e-12	70.5	327	0.071	0.092	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
14	Q91898	1.74e-12	67.8	187	0.075	0.171	HESXB_XENLA Homeobox expressed in ES cells 1-B OS=Xenopus laevis OX=8355 GN=hesx1-b PE=1 SV=2
15	O42356	1.77e-12	70.1	330	0.071	0.091	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
16	Q61658	1.89e-12	67.8	185	0.078	0.178	HESX1_MOUSE Homeobox expressed in ES cells 1 OS=Mus musculus OX=10090 GN=Hesx1 PE=2 SV=2
17	Q9U2Z0	2.05e-12	70.5	391	0.075	0.082	OTXH_CAEEL Homeobox protein ttx-1 OS=Caenorhabditis elegans OX=6239 GN=ttx-1 PE=1 SV=2
18	L8E946	2.71e-12	68.9	279	0.075	0.115	UNC42_CAEEL Homeobox protein unc-42 OS=Caenorhabditis elegans OX=6239 GN=unc-42 PE=1 SV=1
19	A0A2R8QKN2	3.10e-12	68.2	227	0.116	0.216	A0A2R8QKN2_DANRE Homeobox protein prophet of Pit-1 OS=Danio rerio OX=7955 GN=si:ch211-93n23.5 PE=4 SV=1
20	Q91848	4.32e-12	68.2	246	0.061	0.106	SIAM_XENLA Homeobox protein siamois OS=Xenopus laevis OX=8355 GN=siamois PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04218 CENP-B_N	1.6e+02	13.4	CENP-B N-terminal DNA-binding domain
2	PF05920 Homeobox_KN	2.1e-06	38.8	Homeobox KN domain
3	PF00046 Homeodomain	6.4e-32	120.5	Homeodomain
4	PF13384 HTH_23	4.6e+02	12.1	Homeodomain-like domain
5	PF13443 HTH_26	88	15.0	Cro/C1-type HTH DNA-binding domain
6	PF15943 YdaS_antitoxin	2.1e+02	13.4	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451859

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451087	0.932	Double homeobox 4 like 6
2	9606.ENSP00000451207	0.907	Double homeobox 4 like 1
3	9606.ENSP00000451545	0.900	Double homeobox 4 like 2
4	9606.ENSP00000451107	0.864	Double homeobox 4 like 5
5	9606.ENSP00000485452	0.820	Double homeodomain protein DUX4-s
6	9606.ENSP00000451411	0.810	Double homeobox 4 like 7
7	9606.ENSP00000451270	0.807	Double homeobox protein 4-like protein 4
8	9606.ENSP00000458065	0.800	Double homeobox protein 4
9	9606.ENSP00000262932	0.558	Protein canopy homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.998	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.914	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045893	0.999	positive regulation of DNA-templated transcription
GO:0006357	0.997	regulation of transcription by RNA polymerase II
GO:0009987	0.989	cellular process
GO:0045944	0.987	positive regulation of transcription by RNA polymerase II
GO:0048519	0.459	negative regulation of biological process
GO:0048523	0.420	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005829	0.992	cytosol
GO:0012505	0.906	endomembrane system
GO:0005730	0.896	nucleolus
GO:0005794	0.738	Golgi apparatus
GO:0016020	0.461	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]