StarFunc result for job id P0CK96

User Input

>input (405 residues)
MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITE
TTVIESDLGVWSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGC
VKTLVPCCLYQHKARLSYPPNFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAP
IFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNVLGFSAALSTNIMDCLQNV
FSKKLLSGDKYRFSAPELQFYTSAAAVAMLVPARVFFTDVPVIGRSGKSFSYNQDVVLLL
LTDGVLFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSVIVFGNKITSLSAVGTALV
TVGVLLYNKARQHQQEALQSLAAATGRAPDDTVEPLLPQDPRQHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C811	0.857	0.857	1.207E-44	405	0.862	0.862	Q8C811.pdb.gz	S35E2_MOUSE Solute carrier family 35 member E2A OS=Mus musculus OX=10090 GN=Slc35e2a PE=2 SV=1
2	AFDB:Q8H0T6	0.672	0.709	2.761E-17	383	0.222	0.235	Q8H0T6.pdb.gz	PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT2 PE=2 SV=1
3	AFDB:Q8RXN3	0.645	0.640	6.765E-17	408	0.230	0.228	Q8RXN3.pdb.gz	PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
4	AFDB:Q5VQL3	0.658	0.677	7.368E-17	393	0.249	0.257	Q5VQL3.pdb.gz	PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT3 PE=2 SV=1
5	AFDB:Q69VR7	0.653	0.649	3.013E-16	408	0.230	0.228	Q69VR7.pdb.gz	PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT1 PE=2 SV=1
6	AFDB:Q9SFE9	0.635	0.748	7.076E-16	341	0.220	0.261	Q9SFE9.pdb.gz	GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana OX=3702 GN=GONST5 PE=2 SV=1
7	AFDB:Q84QU8	0.654	0.651	8.042E-16	407	0.220	0.219	Q84QU8.pdb.gz	PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT2 PE=2 SV=1
8	AFDB:Q9LF61	0.667	0.649	9.540E-16	417	0.254	0.247	Q9LF61.pdb.gz	XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=XPT PE=1 SV=1
9	AFDB:Q9M5A9	0.616	0.641	1.342E-15	388	0.240	0.250	Q9M5A9.pdb.gz	GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT1 PE=1 SV=1
10	AFDB:Q94B38	0.623	0.648	2.546E-15	388	0.232	0.242	Q94B38.pdb.gz	GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT2 PE=2 SV=2
11	PDB:6xboA	0.479	0.581	4.712E-8	319	0.136	0.172	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
12	PDB:5ogeG	0.577	0.735	2.011E-7	306	0.111	0.147	5ogeG.pdb.gz
13	PDB:3lrbA	0.173	0.172	3.252E-2	410	0.106	0.105	3lrbA.pdb.gz
14	PDB:5j4nA	0.169	0.162	8.315E-2	437	0.104	0.096	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
15	PDB:7tvzA	0.132	0.083	8.315E-2	850	0.136	0.065	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
16	PDB:4yzfA	0.146	0.129	1.511E-1	475	0.133	0.114	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
17	PDB:7vv6R	0.123	0.168	1.511E-1	271	0.111	0.166	7vv6R.pdb.gz	Structure, function and pharmacology of human itch receptor complexes.
18	PDB:7p9uB	0.159	0.147	1.646E-1	455	0.106	0.095	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
19	PDB:6oz6D	0.188	0.241	1.871E-1	288	0.116	0.163	6oz6D.pdb.gz	Chemical logic of MraY inhibition by antibacterial nucleoside natural products.
20	PDB:8cs9g	0.134	0.083	1.953E-1	832	0.143	0.070	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C811	0.0	696	405	0.862	0.862	S35E2_MOUSE Solute carrier family 35 member E2A OS=Mus musculus OX=10090 GN=Slc35e2a PE=2 SV=1
2	P0CK97	1.99e-139	400	266	0.484	0.737	S35E2_HUMAN Solute carrier family 35 member E2A OS=Homo sapiens OX=9606 GN=SLC35E2A PE=1 SV=1
3	Q9LF61	3.10e-30	122	417	0.227	0.221	XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=XPT PE=1 SV=1
4	Q5VQL3	4.14e-30	121	393	0.190	0.196	PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT3 PE=2 SV=1
5	Q96K37	1.09e-29	120	410	0.207	0.205	S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2
6	Q94B38	1.27e-28	117	388	0.193	0.201	GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT2 PE=2 SV=2
7	Q9SFE9	7.18e-28	114	341	0.225	0.267	GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana OX=3702 GN=GONST5 PE=2 SV=1
8	Q9M5A9	1.99e-27	114	388	0.227	0.237	GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT1 PE=1 SV=1
9	Q8H0T6	1.75e-26	111	383	0.178	0.188	PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT2 PE=2 SV=1
10	Q9C521	3.25e-26	110	336	0.222	0.268	UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana OX=3702 GN=UDP-GALT1 PE=2 SV=1
11	Q84QU8	8.94e-26	109	407	0.170	0.170	PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT2 PE=2 SV=1
12	Q69VR7	4.39e-25	107	408	0.170	0.169	PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT1 PE=2 SV=1
13	Q9ZSR7	4.39e-24	105	410	0.200	0.198	TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPT PE=1 SV=1
14	Q8RXN3	1.77e-21	97.4	408	0.202	0.201	PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
15	Q6DBP3	1.85e-20	93.2	309	0.183	0.239	PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana OX=3702 GN=At5g05820 PE=2 SV=1
16	I1VCA5	5.90e-20	91.7	308	0.183	0.240	I1VCA5_ARATH Putative nucleotide-sugar transporter (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NST PE=2 SV=1
17	Q5XF09	5.90e-20	91.7	308	0.183	0.240	PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana OX=3702 GN=At3g11320 PE=2 SV=1
18	O94695	3.17e-18	88.2	449	0.153	0.138	YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC83.11 PE=1 SV=2
19	Q9FYE5	1.54e-16	82.0	309	0.180	0.236	UUAT1_ARATH UDP-URONIC ACID TRANSPORTER 1 OS=Arabidopsis thaliana OX=3702 GN=UUAT1 PE=1 SV=1
20	Q8I420	1.73e-13	73.2	342	0.116	0.137	Q8I420_PLAF7 Triose phosphate transporter OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0508300 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00892 EamA	7.1e-07	40.9	EamA-like transporter family
2	PF04142 Nuc_sug_transp	1.3	19.7	Nucleotide-sugar transporter
3	PF17307 Smim3	5.5e+02	11.6	Small integral membrane protein 3
4	PF03151 TPT	1.1e-89	312.3	Triose-phosphate Transporter family
5	PF08449 UAA	3.6e-05	34.7	UAA transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000464976	0.635	Zinc finger protein 850
2	9606.ENSP00000485584	0.608	Solute carrier family 35, member G4, pseudogene
3	9606.ENSP00000355577	0.595	Putative thiamine transporter SLC35F3
4	9606.ENSP00000338573	0.564	Guanine nucleotide-binding protein-like 3-like protein
5	9606.ENSP00000313318	0.559	GDP-fucose transporter 1
6	9606.ENSP00000378265	0.553	Sodium/hydrogen exchanger 9B2
7	9606.ENSP00000297524	0.528	Solute carrier family 7 member 13
8	9606.ENSP00000366934	0.528	Polynucleotide 5'-hydroxyl-kinase NOL9
9	9606.ENSP00000311521	0.517	Zinc finger protein 490
10	9606.ENSP00000297307	0.512	Solute carrier family 35 member G3
11	9606.ENSP00000481421	0.511	Putative solute carrier family 22 member 31
12	9606.ENSP00000348380	0.503	Cytochrome P450 family 20 subfamily A member 1
13	9606.ENSP00000400932	0.500	Solute carrier family 35 member G1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	0.999	transmembrane transporter activity
GO:0005515	0.997	protein binding
GO:0008514	0.983	organic anion transmembrane transporter activity
GO:1901505	0.981	carbohydrate derivative transmembrane transporter activity
GO:0015932	0.844	nucleobase-containing compound transmembrane transporter activity
GO:0015291	0.790	secondary active transmembrane transporter activity
GO:0015297	0.663	antiporter activity
GO:0015605	0.463	organophosphate ester transmembrane transporter activity
GO:0005338	0.372	nucleotide-sugar transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.855	cellular process
GO:0071684	0.818	organism emergence from protective structure
GO:0001824	0.817	blastocyst development
GO:0035188	0.597	hatching
GO:0001835	0.573	blastocyst hatching
GO:0006810	0.558	transport
GO:0071702	0.511	organic substance transport
GO:0055085	0.419	transmembrane transport
GO:0071705	0.370	nitrogen compound transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005794	0.962	Golgi apparatus
GO:0016020	0.960	membrane
GO:0031090	0.553	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]