StarFunc result for job id P0CK97

User Input

>input (266 residues)
MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITE
TTVIESDLGVWSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGC
VKTLVPCCLYQHKARLSYPPNFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAP
IFTVIMSRMILGEYTGRPSDREEREELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP
GDFQVPQALHRVALSMALPCPMLPAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CK97	1.000	1.000	2.087E-39	266	1.000	1.000	P0CK97.pdb.gz	S35E2_HUMAN Solute carrier family 35 member E2A OS=Homo sapiens OX=9606 GN=SLC35E2A PE=1 SV=1
2	AFDB:Q8C811	0.346	0.247	5.411E-17	405	0.628	0.412	Q8C811.pdb.gz	S35E2_MOUSE Solute carrier family 35 member E2A OS=Mus musculus OX=10090 GN=Slc35e2a PE=2 SV=1
3	AFDB:P33311	0.123	0.057	5.196E-1	773	0.109	0.038	P33311.pdb.gz	MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDL2 PE=1 SV=3
4	AFDB:Q8R0Z6	0.176	0.112	5.894E-1	457	0.109	0.063	Q8R0Z6.pdb.gz	ANGL6_MOUSE Angiopoietin-related protein 6 OS=Mus musculus OX=10090 GN=Angptl6 PE=2 SV=1
5	AFDB:Q9ESN9	0.116	0.031	8.603E-1	1337	0.199	0.040	Q9ESN9.pdb.gz	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
6	AFDB:Q91ZR5	0.129	0.072	9.162E-1	686	0.132	0.051	Q91ZR5.pdb.gz	CTSR1_MOUSE Cation channel sperm-associated protein 1 OS=Mus musculus OX=10090 GN=Catsper1 PE=1 SV=1
7	AFDB:Q8R2X8	0.152	0.112	9.758E-1	403	0.158	0.104	Q8R2X8.pdb.gz	GO45_MOUSE Golgin-45 OS=Mus musculus OX=10090 GN=Blzf1 PE=1 SV=2
8	AFDB:A0A1D5PFN2	0.171	0.138	1.039	342	0.094	0.073	A0A1D5PFN2.pdb.gz	A0A1D5PFN2_CHICK Paralemmin OS=Gallus gallus OX=9031 GN=PALM PE=3 SV=1
9	AFDB:Q57W72	0.133	0.057	1.337	737	0.158	0.057	Q57W72.pdb.gz	Q57W72_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.420 PE=4 SV=1
10	AFDB:O88627	0.129	0.066	1.517	660	0.117	0.047	O88627.pdb.gz	S28A2_MOUSE Sodium/nucleoside cotransporter 2 OS=Mus musculus OX=10090 GN=Slc28a2 PE=1 SV=2
11	PDB:6nq0A	0.134	0.073	7.115	621	0.053	0.023	6nq0A.pdb.gz	Structural mechanisms of phospholipid activation of the human TPC2 channel.
12	PDB:7ryqB	0.161	0.099	7.578	527	0.056	0.028	7ryqB.pdb.gz
13	PDB:7nvrk	0.144	0.250	8.596	133	0.056	0.113	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
14	PDB:7tysA	0.108	0.084	8.596	361	0.090	0.066	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
15	PDB:7np7D1	0.108	0.068	9.155	485	0.041	0.023	7np7D1.pdb.gz
16	PDB:7o3hG	0.114	0.258	9.750	80	0.034	0.113	7o3hG.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CK97	0.0	542	266	1.000	1.000	S35E2_HUMAN Solute carrier family 35 member E2A OS=Homo sapiens OX=9606 GN=SLC35E2A PE=1 SV=1
2	Q8C811	3.47e-108	320	405	0.628	0.412	S35E2_MOUSE Solute carrier family 35 member E2A OS=Mus musculus OX=10090 GN=Slc35e2a PE=2 SV=1
3	Q9LF61	0.004	40.4	417	0.124	0.079	XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=XPT PE=1 SV=1
4	Q9M5A9	0.004	40.4	388	0.139	0.095	GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT1 PE=1 SV=1
5	Q9C521	0.006	39.7	336	0.124	0.098	UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana OX=3702 GN=UDP-GALT1 PE=2 SV=1
6	Q9SFE9	0.006	40.0	341	0.120	0.094	GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana OX=3702 GN=GONST5 PE=2 SV=1
7	Q6ICL7	0.011	38.9	350	0.117	0.089	S35E4_HUMAN Solute carrier family 35 member E4 OS=Homo sapiens OX=9606 GN=SLC35E4 PE=1 SV=1
8	Q5VQL3	0.012	38.9	393	0.068	0.046	PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT3 PE=2 SV=1
9	H7C1I0	0.014	38.9	344	0.086	0.067	H7C1I0_HUMAN Solute carrier family 35 member E1 (Fragment) OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2
10	Q8H0T6	0.039	37.4	383	0.113	0.078	PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT2 PE=2 SV=1
11	Q8RXN3	0.045	37.4	408	0.124	0.081	PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1
12	Q94B38	0.069	36.6	388	0.064	0.044	GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GPT2 PE=2 SV=2
13	B3KQH0	0.071	36.6	364	0.154	0.113	B3KQH0_HUMAN Solute carrier family 35, member C1, isoform CRA_b OS=Homo sapiens OX=9606 GN=SLC35C1 PE=2 SV=1
14	Q96A29	0.071	36.6	364	0.154	0.113	FUCT1_HUMAN GDP-fucose transporter 1 OS=Homo sapiens OX=9606 GN=SLC35C1 PE=1 SV=1
15	Q96K37	0.085	36.6	410	0.060	0.039	S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens OX=9606 GN=SLC35E1 PE=1 SV=2
16	Q69VR7	0.20	35.4	408	0.060	0.039	PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT1 PE=2 SV=1
17	Q84QU8	0.23	35.0	407	0.060	0.039	PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=PPT2 PE=2 SV=1
18	Q8BLX4	0.27	34.7	363	0.154	0.113	FUCT1_MOUSE GDP-fucose transporter 1 OS=Mus musculus OX=10090 GN=Slc35c1 PE=2 SV=1
19	Q9ZSR7	0.33	34.7	410	0.113	0.073	TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPT PE=1 SV=1
20	I1VCA5	0.90	33.1	308	0.113	0.097	I1VCA5_ARATH Putative nucleotide-sugar transporter (Fragment) OS=Arabidopsis thaliana OX=3702 GN=NST PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00892 EamA	0.2	23.3	EamA-like transporter family
2	PF03151 TPT	2.6e-27	107.5	Triose-phosphate Transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246421

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000464976	0.663	Zinc finger protein 850
2	9606.ENSP00000381089	0.646	Solute carrier family 35 member E3
3	9606.ENSP00000318960	0.645	Solute carrier family 35 member C2
4	9606.ENSP00000485584	0.642	Solute carrier family 35, member G4, pseudogene
5	9606.ENSP00000355577	0.598	Putative thiamine transporter SLC35F3
6	9606.ENSP00000338573	0.596	Guanine nucleotide-binding protein-like 3-like protein
7	9606.ENSP00000313318	0.575	GDP-fucose transporter 1
8	9606.ENSP00000378265	0.570	Sodium/hydrogen exchanger 9B2
9	9606.ENSP00000366934	0.563	Polynucleotide 5'-hydroxyl-kinase NOL9
10	9606.ENSP00000311521	0.556	Zinc finger protein 490
11	9606.ENSP00000297524	0.544	Solute carrier family 7 member 13
12	9606.ENSP00000481421	0.529	Putative solute carrier family 22 member 31
13	9606.ENSP00000297307	0.522	Solute carrier family 35 member G3
14	9606.ENSP00000400932	0.518	Solute carrier family 35 member G1
15	9606.ENSP00000348380	0.513	Cytochrome P450 family 20 subfamily A member 1
16	9606.ENSP00000372612	0.510	Solute carrier family 25 member 52
17	9606.ENSP00000371872	0.509	Solute carrier family 35 member G5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.642	transmembrane transporter activity
GO:0015297	0.410	antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.807	cellular process
GO:0032502	0.685	developmental process
GO:0032501	0.612	multicellular organismal process
GO:0006810	0.409	transport
GO:0008152	0.351	metabolic process
GO:0048856	0.350	anatomical structure development
GO:0071704	0.337	organic substance metabolic process
GO:0007275	0.311	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005794	0.994	Golgi apparatus
GO:0016020	0.894	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]