StarFunc result for job id P0DH78

[Download result.tar.bz2 for all prediction results]

User Input

>input (156 residues)
MQDAAAGGPPGLGGGGPPEERTDCIICCSAYDLSGHLPRRLYCGHTFCQACVRRLDTPAP
EQRWIPCPQCRQSTPTPRGGVAMLDLDLAAFLAVKAEREPARLEPLPLTSLKGSAITRQP
AGLCPALGPQPHFPQPRYCCWGCGSLCCPPLGSPEV

Download query sequence and structure.

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXI6	0.455	0.321	3.183E-8	227	0.212	0.145	Q9NXI6.pdb.gz	RN186_HUMAN E3 ubiquitin-protein ligase RNF186 OS=Homo sapiens OX=9606 GN=RNF186 PE=1 SV=1
2	AFDB:P36406	0.458	0.131	4.595E-7	574	0.212	0.057	P36406.pdb.gz	TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens OX=9606 GN=TRIM23 PE=1 SV=1
3	AFDB:Q8N6D2	0.476	0.310	1.143E-6	247	0.231	0.146	Q8N6D2.pdb.gz	RN182_HUMAN E3 ubiquitin-protein ligase RNF182 OS=Homo sapiens OX=9606 GN=RNF182 PE=1 SV=1
4	AFDB:O01481	0.407	0.233	2.192E-6	283	0.179	0.099	O01481.pdb.gz	O01481_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C06A5.8 PE=1 SV=1
5	AFDB:A0A384LEC9	0.425	0.262	4.204E-6	263	0.205	0.122	A0A384LEC9.pdb.gz	A0A384LEC9_ARATH RING-type domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g29270 PE=1 SV=1
6	AFDB:E7F1U3	0.421	0.101	8.604E-6	774	0.224	0.045	E7F1U3.pdb.gz	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
7	AFDB:Q8BG47	0.423	0.331	4.677E-5	203	0.224	0.172	Q8BG47.pdb.gz	RN152_MOUSE E3 ubiquitin-protein ligase RNF152 OS=Mus musculus OX=10090 GN=Rnf152 PE=1 SV=1
8	AFDB:Q9H8W5	0.418	0.124	4.991E-5	580	0.199	0.053	Q9H8W5.pdb.gz	TRI45_HUMAN E3 ubiquitin-protein ligase TRIM45 OS=Homo sapiens OX=9606 GN=TRIM45 PE=1 SV=2
9	AFDB:Q2Q1W2	0.324	0.066	9.571E-5	868	0.199	0.036	Q2Q1W2.pdb.gz	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1
10	AFDB:Q8QZS5	0.439	0.364	9.571E-5	190	0.224	0.184	Q8QZS5.pdb.gz	RN183_MOUSE E3 ubiquitin-protein ligase RNF183 OS=Mus musculus OX=10090 GN=Rnf183 PE=1 SV=1
11	PDB:8a3tU	0.264	0.340	1.102E-2	114	0.160	0.219	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
12	PDB:5dkaA	0.233	0.361	3.559E-2	96	0.135	0.219	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:4kblA	0.272	0.123	4.928E-2	395	0.128	0.051	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
14	PDB:7kzpL	0.255	0.120	1.309E-1	370	0.109	0.046	7kzpL.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	PDB:7oniH	0.257	0.119	1.491E-1	380	0.096	0.039	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:7qcdC	0.281	0.178	1.491E-1	267	0.090	0.052	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:7b5lH	0.170	0.067	3.051E-1	423	0.090	0.033	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
18	PDB:7od1A	0.269	0.110	3.256E-1	430	0.090	0.033	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
19	PDB:7oikA	0.326	0.014	6.664E-1	4426	0.096	0.003	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
20	PDB:3m62A	0.328	0.061	1.051	955	0.045	0.007	3m62A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O01481	4.68e-08	52.8	283	0.167	0.092	O01481_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C06A5.8 PE=1 SV=1
2	Q96D59	6.60e-08	51.6	192	0.244	0.198	RN183_HUMAN E3 ubiquitin-protein ligase RNF183 OS=Homo sapiens OX=9606 GN=RNF183 PE=1 SV=2
3	Q9H0X6	3.29e-07	50.4	261	0.231	0.138	RN208_HUMAN RING finger protein 208 OS=Homo sapiens OX=9606 GN=RNF208 PE=1 SV=2
4	Q8QZS5	3.92e-07	49.7	190	0.237	0.195	RN183_MOUSE E3 ubiquitin-protein ligase RNF183 OS=Mus musculus OX=10090 GN=Rnf183 PE=1 SV=1
5	F4HY36	4.89e-07	50.4	1805	0.186	0.016	F4HY36_ARATH Protein translocase subunit SecA OS=Arabidopsis thaliana OX=3702 GN=SECA2 PE=1 SV=1
6	E7F1U3	6.96e-06	47.0	774	0.154	0.031	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
7	Q58ER5	4.22e-05	44.7	744	0.147	0.031	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
8	O01482	1.26e-04	43.1	381	0.135	0.055	O01482_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rnf-1 PE=1 SV=2
9	Q9C040	1.75e-04	42.7	744	0.154	0.032	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
10	Q9ESN6	1.89e-04	42.7	744	0.154	0.032	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
11	F1QFW2	2.04e-04	42.7	744	0.160	0.034	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
12	D3ZQG6	2.16e-04	42.7	744	0.154	0.032	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
13	Q80VI1	3.95e-04	42.0	734	0.147	0.031	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1
14	Q5PP23	0.001	40.8	562	0.141	0.039	FLY1_ARATH Transmembrane E3 ubiquitin-protein ligase FLY1 OS=Arabidopsis thaliana OX=3702 GN=FLY1 PE=1 SV=1
15	Q8IUD6	0.001	40.4	432	0.192	0.069	RN135_HUMAN E3 ubiquitin-protein ligase RNF135 OS=Homo sapiens OX=9606 GN=RNF135 PE=1 SV=2
16	Q9NXI6	0.001	39.7	227	0.154	0.106	RN186_HUMAN E3 ubiquitin-protein ligase RNF186 OS=Homo sapiens OX=9606 GN=RNF186 PE=1 SV=1
17	O17099	0.002	39.3	374	0.179	0.075	O17099_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F42G2.5 PE=1 SV=1
18	Q8N6D2	0.003	38.9	247	0.160	0.101	RN182_HUMAN E3 ubiquitin-protein ligase RNF182 OS=Homo sapiens OX=9606 GN=RNF182 PE=1 SV=1
19	Q9FY48	0.004	39.3	1625	0.147	0.014	KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana OX=3702 GN=KEG PE=1 SV=2
20	P36406	0.006	38.5	574	0.199	0.054	TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens OX=9606 GN=TRIM23 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02318 FYVE_2	1.9e+02	13.6	FYVE-type zinc finger
2	PF00097 zf-C3HC4	0.3	22.3	Zinc finger, C3HC4 type (RING finger)
3	PF15227 zf-C3HC4_4	40	15.7	zinc finger of C3HC4-type, RING
4	PF13639 zf-RING_2	0.023	26.4	Ring finger domain
5	PF14634 zf-RING_5	0.065	24.5	zinc-RING finger domain
6	PF13445 zf-RING_UBOX	0.023	26.1	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Download graph for PPI

Top PPI partners to 7897.ENSLACP00000022565

Rank	PPI partner	STRING score	Description
1	7897.ENSLACP00000000662	0.716	Growth factor receptor-bound protein 2a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

Download graph for Molecular Function (MF)

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Download graph for Biological Process (BP)

GO term	C-score	Name
GO:0070647	0.995	protein modification by small protein conjugation or removal
GO:0016567	0.994	protein ubiquitination
GO:0051865	0.354	protein autoubiquitination
GO:0009987	0.303	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Download graph for Cellular Component (CC)

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005737	0.976	cytoplasm
GO:0043226	0.969	organelle
GO:0043229	0.964	intracellular organelle
GO:0071944	0.958	cell periphery
GO:0043227	0.955	membrane-bounded organelle
GO:0016020	0.939	membrane
GO:0005886	0.921	plasma membrane
GO:0043231	0.919	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Download sequence-, structure-, PPI-, deep learning-, Pfam family-based function prediction and the final consensus prediction

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[Download result.tar.bz2 for all prediction results]

[back to server]