StarFunc result for job id P0DJD1

User Input

>input (1756 residues)
MRRSKAYGERYLASVQGSAPSPGKKLRGFYFAKLYYEAKEYDLAKKYVCTYLSVQERDPR
AHRFLGLLYELEENTEKAVECYRRSLELNPPQKDLVLKIAELLCKNDVTDGRAKYWVERA
AKLFPGSPAIYKLKEHLLDCEGEDGWNKLFDWIQSELYVRPDDVHMNIRLVELYRSNKRL
KDAVARCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYAN
LMLLTLSTRDVQESRELLESFDSALQSAKSSLGGNDELSATFLEMKGHFYMHAGSLLLKM
GQHGNNVQWQALSELAALCYVIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLLN
LSRGKQDFLKEVVETFANKSGQSVLYNALFSSQSSKDTSFLGSDDIGNIDVQEPELEDLA
RYDVGAIQAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPQETSRLETNAPESIC
ILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKRLCTERQKSWWDAVCTLIH
RKAVPGNSAELRLVVQHEINTLRAQEKHGLQPALLVHWAKCLQKMGRGLNSSYDQQEYIG
RSVHYWKKVLPLLKIIKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAILDAVH
GNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDAVFPEEQEECKNYLRKTRDYLIKI
IDDSDSNLSVVKKLPVPLESVKEMLKSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTPS
PTKYSLSPSKSYKYSPKTPPRWAEDQNSLRKMICQEVKAITKLNSSKSASRHRWPTENYG
PDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKGSSNTEFK
STKEGFSIAVSADGFKFGISEPGNQEKKSEKPLENDTGFQAQDISGQKNGRGVIFGQTSS
TFTFADVAKSTSGEGFQFGKKDPNFKGFSGAGEKLFSSQCGKMANKANTSGDFEKDDDAC
KTEDSDDIHFEPVVQMPEKVELVTGEEGEKVLYSQGVKLFRFDAEISQWKERGLGNLKIL
KNEVNGKPRMLMRRDQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLERLA
AQFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTF
LTNDQTKVTEEENKGSGTGAAGASDTTIKPNPENTGPTLEWDNYDLREDALDDNVSSSSV
HDSPLASSPVRKNIFRFDESTTGFNFSFKSALSLSKSPAKLNQSGTSVGTDEESDVTQEE
ERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHMAELYRYDKDVGQWKERGIGDIKILQNY
DNKQVRIVMRRDQVLKLCANHRITPDMSLQNMKGTERVWVWTACDFADGERKVEHLAVRF
KLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAVLEETTRERTDVI
QGDDVADAASEVEVSSTSETTTKAVVSPPKFVFGSESVKRIFSSEKSNPFAFGNSSATGS
LFGFSFNAPLKSNDSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKNLSASFPME
ESSINYTFKTPEKEPPLWHAEFTKEELVQKLSSTTKSADQLNGLLRETEATSAVLMEQIK
LLKSEIRRLERNQEESAANVEHLKNVLLQFIFLKPGSERESLLPVINTMLQLSPEEKGKL
AAVAQGLQETSIPKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5j00	0.405	0.904	1.172E-81	756	0.401	0.931	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:Q8RWG8	0.075	0.578	1.488E-12	217	0.041	0.332	Q8RWG8.pdb.gz	RBP1B_ARATH Ran-binding protein 1 homolog b OS=Arabidopsis thaliana OX=3702 GN=RANBP1B PE=1 SV=2
3	AFDB:Q9LMK7	0.075	0.552	1.737E-12	228	0.044	0.338	Q9LMK7.pdb.gz	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
4	AFDB:Q09717	0.076	0.582	5.138E-12	215	0.043	0.353	Q09717.pdb.gz	RANG_SCHPO Ran-specific GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sbp1 PE=1 SV=1
5	AFDB:P92985	0.075	0.576	8.500E-12	219	0.042	0.338	P92985.pdb.gz	RBP1C_ARATH Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1
6	AFDB:P41920	0.076	0.636	1.580E-11	201	0.047	0.413	P41920.pdb.gz	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
7	PDB:1k5dB	0.076	0.858	2.860E-11	146	0.040	0.479	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
8	AFDB:A0A1D8PRQ3	0.076	0.607	3.297E-11	212	0.044	0.368	A0A1D8PRQ3.pdb.gz	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
9	PDB:3m1iB	0.074	0.955	3.156E-10	131	0.035	0.466	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
10	PDB:7dkhI	0.079	0.136	3.422E-8	914	0.057	0.109	7dkhI.pdb.gz
11	AFDB:E1C2U2	0.088	0.072	3.944E-8	2326	0.142	0.107	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
12	PDB:4bujB	0.094	0.114	6.610E-8	1367	0.060	0.078	4bujB.pdb.gz
13	AFDB:Q6PR54	0.071	0.059	9.247E-8	2419	0.115	0.084	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
14	AFDB:F4IAT2	0.082	0.080	1.416E-7	1823	0.116	0.111	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
15	AFDB:Q9VW47	0.066	0.055	7.201E-7	2531	0.112	0.078	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
16	PDB:6tedQ	0.092	0.152	4.009E-6	890	0.063	0.125	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:6yj6A	0.088	0.171	7.450E-6	819	0.051	0.109	6yj6A.pdb.gz
18	PDB:7ntfA	0.098	0.172	1.439E-5	918	0.044	0.084	7ntfA.pdb.gz
19	PDB:7qdrB	0.109	0.150	1.496E-5	1212	0.068	0.098	7qdrB.pdb.gz
20	PDB:6c95A	0.110	0.228	6.269E-5	773	0.049	0.111	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC36	0.0	1277	3114	0.374	0.211	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
2	D4A054	0.0	1277	3061	0.374	0.215	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
3	M0R3M4	0.0	1276	3089	0.374	0.213	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
4	P49792	0.0	1421	3224	0.403	0.220	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
5	Q9ERU9	0.0	1300	3053	0.374	0.215	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
6	Q8IWJ2	1.61e-55	216	1684	0.063	0.065	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
7	Q8CHG3	2.49e-49	196	1680	0.056	0.058	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
8	P41920	2.07e-39	147	201	0.046	0.403	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
9	P34022	4.89e-37	141	203	0.044	0.384	RANG_MOUSE Ran-specific GTPase-activating protein OS=Mus musculus OX=10090 GN=Ranbp1 PE=1 SV=2
10	A0A140VK94	5.32e-37	140	201	0.043	0.373	A0A140VK94_HUMAN RAN binding protein 1, isoform CRA_g OS=Homo sapiens OX=9606 GN=RANBP1 PE=2 SV=1
11	P43487	5.32e-37	140	201	0.043	0.373	RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
12	A0A8I5ZTU5	9.02e-37	140	219	0.043	0.342	A0A8I5ZTU5_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=1
13	D4A2G9	1.71e-36	139	188	0.041	0.383	D4A2G9_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=2
14	F6WQW2	3.51e-36	141	278	0.044	0.281	F6WQW2_HUMAN RAN binding protein 1 OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
15	A0A1D8PRQ3	9.86e-34	132	212	0.035	0.292	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
16	Q21021	9.69e-33	140	860	0.035	0.072	Q21021_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=2
17	C9JJ34	3.65e-31	122	163	0.038	0.405	C9JJ34_HUMAN RAN binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
18	A0A0B4K7J2	1.98e-30	134	2718	0.042	0.027	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
19	Q09717	2.97e-30	122	215	0.041	0.335	RANG_SCHPO Ran-specific GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sbp1 PE=1 SV=1
20	Q9LMK7	4.22e-30	122	228	0.035	0.272	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10473 CENP-F_leu_zip	14	17.2	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
2	PF01465 GRIP	6.3e-12	56.5	GRIP domain
3	PF16704 Rab_bind	1.9e-31	119.2	Rab binding domain
4	PF00638 Ran_BP1	1.8e-103	352.9	RanBP1 domain
5	PF00515 TPR_1	0.015	26.3	Tetratricopeptide repeat
6	PF13414 TPR_11	2.5e+02	12.8	TPR repeat
7	PF13428 TPR_14	18	17.5	Tetratricopeptide repeat
8	PF13432 TPR_16	0.2	23.6	Tetratricopeptide repeat
9	PF14559 TPR_19	6.5	18.6	Tetratricopeptide repeat
10	PF07719 TPR_2	0.0057	27.7	Tetratricopeptide repeat
11	PF13174 TPR_6	2.7e+02	13.7	Tetratricopeptide repeat
12	PF13176 TPR_7	8.6	17.7	Tetratricopeptide repeat
13	PF13181 TPR_8	0.095	24.0	Tetratricopeptide repeat
14	PF13371 TPR_9	23	16.5	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401470	0.967	Ran GTPase-activating protein 1
2	9606.ENSP00000352400	0.935	Nuclear pore complex protein Nup214
3	9606.ENSP00000444029	0.931	Nuclear pore complex protein Nup153
4	9606.ENSP00000446215	0.928	GTP-binding nuclear protein Ran
5	9606.ENSP00000471191	0.918	Nuclear pore glycoprotein p62
6	9606.ENSP00000384863	0.917	Exportin-1
7	9606.ENSP00000316032	0.880	Nuclear pore complex protein Nup98-Nup96
8	9606.ENSP00000458954	0.858	Nuclear pore complex protein Nup88
9	9606.ENSP00000310668	0.834	Nuclear pore complex protein Nup93
10	9606.ENSP00000266679	0.820	Cleavage and polyadenylation specificity factor subunit 6
11	9606.ENSP00000356448	0.820	Nucleoprotein TPR
12	9606.ENSP00000229179	0.811	Nuclear pore complex protein Nup107
13	9606.ENSP00000231498	0.810	Nuclear pore complex protein Nup155
14	9606.ENSP00000261396	0.804	Nuclear pore complex protein Nup133
15	9606.ENSP00000265388	0.799	Transportin-3
16	9606.ENSP00000285968	0.796	Nuclear pore complex protein Nup205
17	9606.ENSP00000264883	0.794	Nucleoporin p54
18	9606.ENSP00000355465	0.781	Protein ELYS
19	9606.ENSP00000254508	0.774	Nuclear pore membrane glycoprotein 210
20	9606.ENSP00000409666	0.771	Small ubiquitin-like modifier 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019789	0.997	SUMO transferase activity
GO:0044877	0.995	protein-containing complex binding
GO:0031267	0.993	small GTPase binding
GO:0061665	0.971	SUMO ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.965	cellular process
GO:0051179	0.917	localization
GO:0051641	0.887	cellular localization
GO:0050896	0.861	response to stimulus
GO:0065007	0.811	biological regulation
GO:0050789	0.768	regulation of biological process
GO:0051649	0.766	establishment of localization in cell
GO:0046907	0.744	intracellular transport
GO:0051169	0.663	nuclear transport
GO:0042221	0.661	response to chemical
GO:0008152	0.628	metabolic process
GO:0050794	0.620	regulation of cellular process
GO:0006913	0.608	nucleocytoplasmic transport
GO:0071704	0.603	organic substance metabolic process
GO:0043170	0.555	macromolecule metabolic process
GO:0033036	0.540	macromolecule localization
GO:0070727	0.437	cellular macromolecule localization
GO:0008104	0.430	protein localization
GO:0071705	0.422	nitrogen compound transport
GO:0071702	0.422	organic substance transport
GO:0019222	0.370	regulation of metabolic process
GO:0048518	0.323	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0031981	0.996	nuclear lumen
GO:0005643	0.995	nuclear pore
GO:0005829	0.966	cytosol
GO:0005654	0.953	nucleoplasm
GO:0016020	0.920	membrane
GO:1902494	0.377	catalytic complex
GO:0042175	0.377	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0106068	0.371	SUMO ligase complex
GO:0043232	0.365	intracellular non-membrane-bounded organelle
GO:0044614	0.363	nuclear pore cytoplasmic filaments
GO:0005642	0.359	annulate lamellae
GO:0016234	0.354	inclusion body
GO:0044615	0.349	nuclear pore nuclear basket
GO:0042405	0.343	nuclear inclusion body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.

[back to server]