StarFunc result for job id P0DJI8

User Input

>input (122 residues)
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY
DAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPE
KY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DJI8	1.000	1.000	1.586E-17	122	1.000	1.000	P0DJI8.pdb.gz	SAA1_HUMAN Serum amyloid A-1 protein OS=Homo sapiens OX=9606 GN=SAA1 PE=1 SV=1
2	AFDB:B0M1H2	0.916	0.868	9.384E-15	129	0.861	0.814	B0M1H2.pdb.gz	B0M1H2_ACIJB Serum amyloid A protein OS=Acinonyx jubatus OX=32536 GN=Saa1 PE=1 SV=1
3	AFDB:P04918	0.982	0.982	1.153E-14	122	0.697	0.697	P04918.pdb.gz	SAA3_MOUSE Serum amyloid A-3 protein OS=Mus musculus OX=10090 GN=Saa3 PE=1 SV=1
4	PDB:4ip8A	0.840	0.973	2.365E-14	105	0.852	0.990	4ip8A.pdb.gz
5	AFDB:Q2HXZ9	0.960	0.902	3.066E-14	130	0.762	0.715	Q2HXZ9.pdb.gz	Q2HXZ9_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 GN=SAA3 PE=1 SV=1
6	AFDB:P05366	0.952	0.952	1.956E-13	122	0.738	0.738	P05366.pdb.gz	SAA1_MOUSE Serum amyloid A-1 protein OS=Mus musculus OX=10090 GN=Saa1 PE=1 SV=2
7	PDB:6pxzB	0.832	0.984	3.810E-13	103	0.631	0.748	6pxzB.pdb.gz	Molecular basis for retinol binding by serum amyloid A during infection.
8	AFDB:F1S9C0	0.866	0.798	1.533E-12	133	0.762	0.699	F1S9C0.pdb.gz	F1S9C0_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 PE=3 SV=4
9	AFDB:P35542	0.946	0.889	6.914E-11	130	0.590	0.554	P35542.pdb.gz	SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens OX=9606 GN=SAA4 PE=1 SV=2
10	AFDB:Q642J9	0.841	0.848	2.636E-10	121	0.566	0.570	Q642J9.pdb.gz	Q642J9_DANRE Serum amyloid A protein OS=Danio rerio OX=7955 GN=zgc:103580 PE=2 SV=1
11	PDB:3afeA	0.316	0.117	3.903	384	0.123	0.039	3afeA.pdb.gz
12	AFDB:Q38CU8	0.230	0.099	4.565	346	0.164	0.058	Q38CU8.pdb.gz	Q38CU8_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2390 PE=4 SV=1
13	AFDB:Q54T23	0.280	0.068	4.806	855	0.057	0.008	Q54T23.pdb.gz	Q54T23_DICDI TPR repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282093 PE=4 SV=1
14	PDB:7n8oQ	0.212	0.216	5.049	119	0.123	0.126	7n8oQ.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
15	PDB:4f0xA	0.223	0.068	5.315	456	0.123	0.033	4f0xA.pdb.gz	Structural Asymmetry and Disulfide Bridges among Subunits Modulate the Activity of Human Malonyl-CoA Decarboxylase.
16	PDB:6gzhB	0.233	0.138	5.315	252	0.107	0.052	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
17	PDB:7zw1B	0.366	0.155	6.531	316	0.107	0.041	7zw1B.pdb.gz
18	PDB:7x1tA	0.251	0.135	6.876	272	0.074	0.033	7x1tA.pdb.gz	Structural insights into thyrotropin-releasing hormone receptor activation by an endogenous peptide agonist or its orally administered analogue.
19	PDB:3vprA	0.308	0.229	7.239	189	0.131	0.085	3vprA.pdb.gz
20	PDB:7c1iA	0.351	0.367	7.239	115	0.066	0.070	7c1iA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DJI8	1.39e-87	251	122	1.000	1.000	SAA1_HUMAN Serum amyloid A-1 protein OS=Homo sapiens OX=9606 GN=SAA1 PE=1 SV=1
2	P0DJI9	9.94e-70	206	122	0.926	0.926	SAA2_HUMAN Serum amyloid A-2 protein OS=Homo sapiens OX=9606 GN=SAA2 PE=1 SV=1
3	B0M1H2	6.33e-69	204	129	0.861	0.814	B0M1H2_ACIJB Serum amyloid A protein OS=Acinonyx jubatus OX=32536 GN=Saa1 PE=1 SV=1
4	Q2HXZ9	1.03e-64	194	130	0.779	0.731	Q2HXZ9_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 GN=SAA3 PE=1 SV=1
5	P05366	1.41e-62	188	122	0.738	0.738	SAA1_MOUSE Serum amyloid A-1 protein OS=Mus musculus OX=10090 GN=Saa1 PE=1 SV=2
6	P05367	1.52e-62	188	122	0.738	0.738	SAA2_MOUSE Serum amyloid A-2 protein OS=Mus musculus OX=10090 GN=Saa2 PE=1 SV=1
7	F1S9C0	5.31e-59	179	133	0.779	0.714	F1S9C0_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 PE=3 SV=4
8	P04918	3.49e-56	172	122	0.697	0.697	SAA3_MOUSE Serum amyloid A-3 protein OS=Mus musculus OX=10090 GN=Saa3 PE=1 SV=1
9	Q642J9	2.72e-44	142	121	0.566	0.570	Q642J9_DANRE Serum amyloid A protein OS=Danio rerio OX=7955 GN=zgc:103580 PE=2 SV=1
10	P35542	9.48e-44	141	130	0.590	0.554	SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens OX=9606 GN=SAA4 PE=1 SV=2
11	B9P414	4.13e-42	135	89	0.549	0.753	B9P414_PIG Serum amyloid A protein (Fragment) OS=Sus scrofa OX=9823 PE=2 SV=1
12	P88925	1.7	30.4	486	0.107	0.027	P88925_HHV8 Shutoff alkaline exonuclease OS=Human herpesvirus 8 type M OX=435895 PE=1 SV=1
13	Q04199	2.2	30.0	468	0.139	0.036	CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAC2 PE=1 SV=1
14	P43115	7.2	28.5	390	0.139	0.044	PE2R3_HUMAN Prostaglandin E2 receptor EP3 subtype OS=Homo sapiens OX=9606 GN=PTGER3 PE=1 SV=1
15	E7F958	8.6	28.5	1715	0.156	0.011	E7F958_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00277 SAA	1.4e-46	168.4	Serum amyloid A protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008969745.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003822966.1	0.646	Interleukin 10
2	9597.XP_003822366.1	0.613	Belongs to the calycin superfamily. Lipocalin family.
3	9597.XP_008952318.1	0.603	RELA proto-oncogene, NF-kB subunit
4	9597.XP_008958307.1	0.597	Interleukin 6
5	9597.XP_008949630.1	0.579	Matrix metallopeptidase 9
6	9597.XP_008949506.1	0.551	Lipopolysaccharide-binding protein isoform X1
7	9597.XP_003828423.1	0.543	Matrix metallopeptidase 1
8	9597.XP_003828425.1	0.541	Matrix metallopeptidase 3
9	9597.XP_003833210.1	0.539	interleukin-17A
10	9597.XP_008962796.1	0.539	TIMP metallopeptidase inhibitor 1
11	9597.XP_008964734.1	0.537	Signal transducer and activator of transcription 3
12	9597.XP_003833209.1	0.530	Interleukin 17F
13	9597.XP_008956987.1	0.519	Belongs to the PDGF/VEGF growth factor family.
14	9597.XP_003830003.1	0.516	Nuclear factor kappa B subunit 1
15	9597.XP_003824971.1	0.511	Interleukin-23 subunit alpha
16	9597.XP_008962127.1	0.501	Matrix metallopeptidase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.984	signaling receptor binding
GO:0098772	0.605	molecular function regulator activity
GO:0140677	0.477	molecular function activator activity
GO:0030545	0.441	signaling receptor regulator activity
GO:0042802	0.439	identical protein binding
GO:0048018	0.408	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0019222	0.971	regulation of metabolic process
GO:0009605	0.962	response to external stimulus
GO:0042221	0.941	response to chemical
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0048518	0.925	positive regulation of biological process
GO:0051716	0.885	cellular response to stimulus
GO:0048522	0.884	positive regulation of cellular process
GO:0009893	0.837	positive regulation of metabolic process
GO:0040011	0.820	locomotion
GO:0048519	0.784	negative regulation of biological process
GO:0044238	0.718	primary metabolic process
GO:0071704	0.694	organic substance metabolic process
GO:0048583	0.669	regulation of response to stimulus
GO:0010604	0.652	positive regulation of macromolecule metabolic process
GO:0010468	0.647	regulation of gene expression
GO:0070887	0.587	cellular response to chemical stimulus
GO:0080090	0.561	regulation of primary metabolic process
GO:0009892	0.515	negative regulation of metabolic process
GO:0048584	0.497	positive regulation of response to stimulus
GO:0031323	0.479	regulation of cellular metabolic process
GO:0048523	0.478	negative regulation of cellular process
GO:0051171	0.466	regulation of nitrogen compound metabolic process
GO:0009966	0.455	regulation of signal transduction
GO:0010033	0.453	response to organic substance
GO:0044419	0.448	biological process involved in interspecies interaction between organisms
GO:0002376	0.442	immune system process
GO:0051246	0.438	regulation of protein metabolic process
GO:0007154	0.433	cell communication
GO:0051239	0.422	regulation of multicellular organismal process
GO:0023052	0.370	signaling
GO:0031325	0.358	positive regulation of cellular metabolic process
GO:0009889	0.352	regulation of biosynthetic process
GO:0001817	0.345	regulation of cytokine production
GO:0051707	0.341	response to other organism
GO:0051173	0.341	positive regulation of nitrogen compound metabolic process
GO:0044237	0.330	cellular metabolic process
GO:0006935	0.330	chemotaxis
GO:1902533	0.329	positive regulation of intracellular signal transduction
GO:0010605	0.319	negative regulation of macromolecule metabolic process
GO:0007165	0.316	signal transduction
GO:0051247	0.310	positive regulation of protein metabolic process
GO:0001932	0.309	regulation of protein phosphorylation
GO:0009617	0.308	response to bacterium
GO:0051240	0.305	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0043227	0.997	membrane-bounded organelle
GO:0031982	0.990	vesicle
GO:0070062	0.981	extracellular exosome
GO:0043231	0.698	intracellular membrane-bounded organelle
GO:0005737	0.675	cytoplasm
GO:0070013	0.507	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]