StarFunc result for job id P0DJI9

User Input

>input (122 residues)
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY
DAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPE
KY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DJI8	0.997	0.997	1.333E-16	122	0.926	0.926	P0DJI8.pdb.gz	SAA1_HUMAN Serum amyloid A-1 protein OS=Homo sapiens OX=9606 GN=SAA1 PE=1 SV=1
2	AFDB:B0M1H2	0.926	0.877	5.028E-15	129	0.828	0.783	B0M1H2.pdb.gz	B0M1H2_ACIJB Serum amyloid A protein OS=Acinonyx jubatus OX=32536 GN=Saa1 PE=1 SV=1
3	AFDB:P04918	0.989	0.989	1.873E-14	122	0.672	0.672	P04918.pdb.gz	SAA3_MOUSE Serum amyloid A-3 protein OS=Mus musculus OX=10090 GN=Saa3 PE=1 SV=1
4	PDB:4ip8A	0.835	0.968	2.223E-14	105	0.787	0.914	4ip8A.pdb.gz
5	AFDB:Q2HXZ9	0.985	0.925	2.707E-14	130	0.770	0.723	Q2HXZ9.pdb.gz	Q2HXZ9_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 GN=SAA3 PE=1 SV=1
6	AFDB:P05366	0.961	0.961	9.078E-14	122	0.697	0.697	P05366.pdb.gz	SAA1_MOUSE Serum amyloid A-1 protein OS=Mus musculus OX=10090 GN=Saa1 PE=1 SV=2
7	PDB:6pxzB	0.832	0.985	7.161E-13	103	0.615	0.728	6pxzB.pdb.gz	Molecular basis for retinol binding by serum amyloid A during infection.
8	AFDB:F1S9C0	0.871	0.802	9.190E-13	133	0.746	0.684	F1S9C0.pdb.gz	F1S9C0_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 PE=3 SV=4
9	AFDB:P35542	0.950	0.894	6.515E-11	130	0.557	0.523	P35542.pdb.gz	SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens OX=9606 GN=SAA4 PE=1 SV=2
10	AFDB:Q642J9	0.853	0.860	1.434E-10	121	0.582	0.587	Q642J9.pdb.gz	Q642J9_DANRE Serum amyloid A protein OS=Danio rerio OX=7955 GN=zgc:103580 PE=2 SV=1
11	PDB:4f0xA	0.259	0.080	2.637	456	0.115	0.031	4f0xA.pdb.gz	Structural Asymmetry and Disulfide Bridges among Subunits Modulate the Activity of Human Malonyl-CoA Decarboxylase.
12	PDB:6gzhB	0.257	0.149	3.254	252	0.131	0.063	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
13	AFDB:Q93LJ4	0.277	0.197	3.962	181	0.139	0.094	Q93LJ4.pdb.gz	CHMU_SALTM Monofunctional chorismate mutase OS=Salmonella typhimurium OX=90371 GN=aroQ PE=1 SV=1
14	AFDB:Q54T23	0.277	0.068	4.176	855	0.057	0.008	Q54T23.pdb.gz	Q54T23_DICDI TPR repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282093 PE=4 SV=1
15	PDB:3vprA	0.307	0.229	4.703	189	0.139	0.090	3vprA.pdb.gz
16	PDB:7dyrZ	0.206	0.120	4.703	274	0.123	0.055	7dyrZ.pdb.gz	Structure of the mannose phosphotransferase system (man-PTS) complexed with microcin E492, a pore-forming bacteriocin.
17	PDB:7x1tA	0.251	0.134	4.957	272	0.057	0.026	7x1tA.pdb.gz	Structural insights into thyrotropin-releasing hormone receptor activation by an endogenous peptide agonist or its orally administered analogue.
18	PDB:6pbzA	0.250	0.089	5.507	485	0.123	0.031	6pbzA.pdb.gz
19	PDB:7n8oQ	0.219	0.226	5.507	119	0.115	0.118	7n8oQ.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
20	PDB:1cnt2	0.221	0.208	5.804	130	0.156	0.146	1cnt2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DJI9	1.64e-87	251	122	1.000	1.000	SAA2_HUMAN Serum amyloid A-2 protein OS=Homo sapiens OX=9606 GN=SAA2 PE=1 SV=1
2	P0DJI8	3.28e-81	235	122	0.926	0.926	SAA1_HUMAN Serum amyloid A-1 protein OS=Homo sapiens OX=9606 GN=SAA1 PE=1 SV=1
3	B0M1H2	5.50e-68	202	129	0.828	0.783	B0M1H2_ACIJB Serum amyloid A protein OS=Acinonyx jubatus OX=32536 GN=Saa1 PE=1 SV=1
4	Q2HXZ9	2.50e-64	193	130	0.770	0.723	Q2HXZ9_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 GN=SAA3 PE=1 SV=1
5	P05367	8.05e-60	181	122	0.697	0.697	SAA2_MOUSE Serum amyloid A-2 protein OS=Mus musculus OX=10090 GN=Saa2 PE=1 SV=1
6	P05366	8.59e-60	181	122	0.697	0.697	SAA1_MOUSE Serum amyloid A-1 protein OS=Mus musculus OX=10090 GN=Saa1 PE=1 SV=2
7	F1S9C0	2.44e-58	178	133	0.762	0.699	F1S9C0_PIG Serum amyloid A protein OS=Sus scrofa OX=9823 PE=3 SV=4
8	P04918	5.84e-54	166	122	0.631	0.631	SAA3_MOUSE Serum amyloid A-3 protein OS=Mus musculus OX=10090 GN=Saa3 PE=1 SV=1
9	Q642J9	8.36e-46	146	121	0.582	0.587	Q642J9_DANRE Serum amyloid A protein OS=Danio rerio OX=7955 GN=zgc:103580 PE=2 SV=1
10	B9P414	1.72e-42	136	89	0.549	0.753	B9P414_PIG Serum amyloid A protein (Fragment) OS=Sus scrofa OX=9823 PE=2 SV=1
11	P35542	2.83e-41	135	130	0.549	0.515	SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens OX=9606 GN=SAA4 PE=1 SV=2
12	Q39131	4.1	28.9	172	0.148	0.105	ENL17_ARATH Early nodulin-like protein 17 OS=Arabidopsis thaliana OX=3702 GN=ENODL17 PE=2 SV=1
13	P88925	4.8	28.9	486	0.098	0.025	P88925_HHV8 Shutoff alkaline exonuclease OS=Human herpesvirus 8 type M OX=435895 PE=1 SV=1
14	P61407	6.0	28.9	2134	0.205	0.012	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
15	Q9ZNZ7	6.3	28.9	1622	0.156	0.012	GLTB1_ARATH Ferredoxin-dependent glutamate synthase 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLU1 PE=1 SV=3
16	H8ZPX2	7.4	28.5	477	0.164	0.042	SAPD_PSESP 3-succinoylsemialdehyde-pyridine dehydrogenase OS=Pseudomonas sp. OX=306 GN=ald PE=1 SV=1
17	Q8K2I9	7.5	28.5	1042	0.131	0.015	FBH1_MOUSE F-box DNA helicase 1 OS=Mus musculus OX=10090 GN=Fbh1 PE=1 SV=1
18	Q9Z188	7.6	28.5	629	0.115	0.022	DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus OX=10090 GN=Dyrk1b PE=1 SV=3
19	Q9Y463	8.1	28.5	629	0.115	0.022	DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens OX=9606 GN=DYRK1B PE=1 SV=1
20	P25704	8.4	28.1	434	0.213	0.060	ENOB_RABIT Beta-enolase OS=Oryctolagus cuniculus OX=9986 GN=ENO3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00277 SAA	2e-46	167.9	Serum amyloid A protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348170	0.737	Haptoglobin
2	9606.ENSP00000236850	0.732	Apolipoprotein A-I
3	9606.ENSP00000384906	0.696	Serum amyloid A-1 protein
4	9606.ENSP00000205948	0.675	Beta-2-glycoprotein 1
5	9606.ENSP00000278222	0.660	Serum amyloid A-4 protein
6	9606.ENSP00000365081	0.655	Apolipoprotein M
7	9606.ENSP00000465356	0.641	Apolipoprotein C-I
8	9606.ENSP00000381250	0.635	Apolipoprotein F
9	9606.ENSP00000350425	0.631	Apolipoprotein A-IV
10	9606.ENSP00000445002	0.631	Apolipoprotein A-V
11	9606.ENSP00000317674	0.622	Apolipoprotein L1
12	9606.ENSP00000466775	0.612	Apolipoprotein C-II
13	9606.ENSP00000356969	0.609	Apolipoprotein A-II
14	9606.ENSP00000252486	0.602	Apolipoprotein E
15	9606.ENSP00000264005	0.600	Phosphatidylcholine-sterol acyltransferase
16	9606.ENSP00000233242	0.597	Apolipoprotein B-100
17	9606.ENSP00000222381	0.594	Serum paraoxonase/arylesterase 1
18	9606.ENSP00000227667	0.589	Apolipoprotein C-III
19	9606.ENSP00000468236	0.584	Apolipoprotein C-IV
20	9606.ENSP00000321334	0.581	Apolipoprotein(a)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.941	signaling receptor binding
GO:0098772	0.491	molecular function regulator activity
GO:0042802	0.447	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0065007	0.987	biological regulation
GO:0009987	0.986	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0019222	0.971	regulation of metabolic process
GO:0071704	0.960	organic substance metabolic process
GO:0044238	0.910	primary metabolic process
GO:0048518	0.897	positive regulation of biological process
GO:0042221	0.881	response to chemical
GO:0009605	0.878	response to external stimulus
GO:0051716	0.717	cellular response to stimulus
GO:0002376	0.687	immune system process
GO:0060255	0.648	regulation of macromolecule metabolic process
GO:0006629	0.647	lipid metabolic process
GO:0048522	0.627	positive regulation of cellular process
GO:0070887	0.589	cellular response to chemical stimulus
GO:0060326	0.547	cell chemotaxis
GO:0009893	0.515	positive regulation of metabolic process
GO:0044237	0.488	cellular metabolic process
GO:0048519	0.473	negative regulation of biological process
GO:0044419	0.461	biological process involved in interspecies interaction between organisms
GO:0010468	0.456	regulation of gene expression
GO:0009607	0.447	response to biotic stimulus
GO:0010604	0.446	positive regulation of macromolecule metabolic process
GO:0080090	0.439	regulation of primary metabolic process
GO:0048523	0.438	negative regulation of cellular process
GO:0009892	0.427	negative regulation of metabolic process
GO:0051239	0.424	regulation of multicellular organismal process
GO:0031323	0.411	regulation of cellular metabolic process
GO:0032501	0.322	multicellular organismal process
GO:0001817	0.314	regulation of cytokine production
GO:0009894	0.308	regulation of catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.997	extracellular exosome
GO:0043229	0.806	intracellular organelle
GO:0012505	0.766	endomembrane system
GO:0043231	0.765	intracellular membrane-bounded organelle
GO:0005737	0.720	cytoplasm
GO:0032991	0.508	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]