StarFunc result for job id P0DKB6

User Input

>input (136 residues)
MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTA
LILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPAT
AAAATSPGSQPPKQAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q6Z3	0.447	0.528	2.162E-8	109	0.493	0.615	F1Q6Z3.pdb.gz	F1Q6Z3_DANRE Mitochondrial pyruvate carrier OS=Danio rerio OX=7955 GN=zgc:92707 PE=1 SV=1
2	AFDB:A0A087WVZ0	0.479	0.564	2.824E-8	109	0.456	0.569	A0A087WVZ0.pdb.gz	A0A087WVZ0_HUMAN Mitochondrial pyruvate carrier OS=Homo sapiens OX=9606 GN=MPC1 PE=1 SV=1
3	AFDB:Q7KSC4	0.397	0.480	7.191E-8	107	0.434	0.551	Q7KSC4.pdb.gz	MPC1_DROME Mitochondrial pyruvate carrier 1 OS=Drosophila melanogaster OX=7227 GN=Mpc1 PE=3 SV=1
4	AFDB:O74847	0.548	0.533	6.511E-7	141	0.375	0.362	O74847.pdb.gz	MPC1_SCHPO Probable mitochondrial pyruvate carrier 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mpc1 PE=3 SV=3
5	AFDB:P53157	0.441	0.458	3.232E-6	130	0.338	0.354	P53157.pdb.gz	MPC1_YEAST Mitochondrial pyruvate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPC1 PE=1 SV=1
6	AFDB:O01257	0.286	0.274	2.174	144	0.162	0.153	O01257.pdb.gz	O01257_CAEEL HIG1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T20D3.6 PE=1 SV=1
7	PDB:4jjnA	0.145	0.195	2.199	98	0.081	0.112	4jjnA.pdb.gz	Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
8	AFDB:Q2QX40	0.218	0.092	3.469	465	0.132	0.039	Q2QX40.pdb.gz	ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica OX=39947 GN=STAR3 PE=2 SV=1
9	AFDB:P12979	0.216	0.147	3.965	224	0.132	0.080	P12979.pdb.gz	MYOG_MOUSE Myogenin OS=Mus musculus OX=10090 GN=Myog PE=1 SV=2
10	AFDB:A0A024R207	0.183	0.099	4.844	343	0.125	0.050	A0A024R207.pdb.gz
11	AFDB:Q1D9P3	0.251	0.301	4.844	109	0.140	0.174	Q1D9P3.pdb.gz	ENCD_MYXXD Encapsulin nanocompartment cargo protein EncD OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=encD PE=1 SV=1
12	PDB:5apnh	0.202	0.215	8.935	119	0.044	0.050	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
13	PDB:5z62C	0.233	0.137	9.552	260	0.147	0.077	5z62C.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
14	PDB:8d0kF	0.273	0.051	9.552	915	0.051	0.008	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q6Z3	3.30e-42	137	109	0.478	0.596	F1Q6Z3_DANRE Mitochondrial pyruvate carrier OS=Danio rerio OX=7955 GN=zgc:92707 PE=1 SV=1
2	P63030	1.79e-40	132	109	0.456	0.569	MPC1_MOUSE Mitochondrial pyruvate carrier 1 OS=Mus musculus OX=10090 GN=Mpc1 PE=1 SV=1
3	Q9Y5U8	4.25e-40	132	109	0.449	0.560	MPC1_HUMAN Mitochondrial pyruvate carrier 1 OS=Homo sapiens OX=9606 GN=MPC1 PE=1 SV=1
4	Q7KSC4	1.25e-39	130	107	0.434	0.551	MPC1_DROME Mitochondrial pyruvate carrier 1 OS=Drosophila melanogaster OX=7227 GN=Mpc1 PE=3 SV=1
5	A0A087WVZ0	2.61e-39	129	109	0.441	0.550	A0A087WVZ0_HUMAN Mitochondrial pyruvate carrier OS=Homo sapiens OX=9606 GN=MPC1 PE=1 SV=1
6	O74847	3.26e-34	118	141	0.368	0.355	MPC1_SCHPO Probable mitochondrial pyruvate carrier 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mpc1 PE=3 SV=3
7	P53157	3.30e-29	105	130	0.353	0.369	MPC1_YEAST Mitochondrial pyruvate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPC1 PE=1 SV=1
8	Q949R9	2.05e-25	94.7	110	0.301	0.373	MPC1_ARATH Mitochondrial pyruvate carrier 1 OS=Arabidopsis thaliana OX=3702 GN=MPC1 PE=3 SV=1
9	Q5TI65	3.73e-20	80.1	66	0.279	0.576	Q5TI65_HUMAN Mitochondrial pyruvate carrier OS=Homo sapiens OX=9606 GN=MPC1 PE=1 SV=1
10	P38857	3.96e-11	58.5	129	0.206	0.217	MPC2_YEAST Mitochondrial pyruvate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPC2 PE=1 SV=1
11	Q09896	2.95e-09	53.5	118	0.206	0.237	MPC2_SCHPO Probable mitochondrial pyruvate carrier 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mpc2 PE=3 SV=1
12	P53311	1.38e-08	52.4	146	0.228	0.212	MPC3_YEAST Mitochondrial pyruvate carrier 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPC3 PE=1 SV=1
13	Q5A328	1.19e-07	49.3	132	0.169	0.174	Q5A328_CANAL Mitochondrial pyruvate carrier OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR08610WA PE=3 SV=1
14	Q38FF5	3.89e-07	47.0	86	0.191	0.302	Q38FF5_TRYB2 Mitochondrial pyruvate carrier OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2380 PE=3 SV=1
15	Q8L7H8	1.21e-06	46.2	109	0.169	0.211	MPC2_ARATH Mitochondrial pyruvate carrier 2 OS=Arabidopsis thaliana OX=3702 GN=MPC2 PE=3 SV=1
16	O49636	2.23e-06	45.4	108	0.169	0.213	MPC4_ARATH Mitochondrial pyruvate carrier 4 OS=Arabidopsis thaliana OX=3702 GN=MPC4 PE=3 SV=1
17	Q8LD38	2.74e-05	42.7	108	0.140	0.176	MPC3_ARATH Mitochondrial pyruvate carrier 3 OS=Arabidopsis thaliana OX=3702 GN=MPC3 PE=2 SV=1
18	Q9D023	0.002	38.1	127	0.140	0.150	MPC2_MOUSE Mitochondrial pyruvate carrier 2 OS=Mus musculus OX=10090 GN=Mpc2 PE=1 SV=1
19	O95563	0.011	36.2	127	0.132	0.142	MPC2_HUMAN Mitochondrial pyruvate carrier 2 OS=Homo sapiens OX=9606 GN=MPC2 PE=1 SV=1
20	A0A6I8PIX7	0.64	32.0	1904	0.110	0.008	A0A6I8PIX7_HUMAN Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03650 MPC	3.6e-26	102.8	Mitochondrial pyruvate carriers

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003815418.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003824654.1	0.947	Mediates the uptake of pyruvate into mitochondria.
2	9597.XP_003819481.1	0.776	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 694 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
3	9597.XP_003830152.1	0.721	NADH:ubiquinone oxidoreductase subunit B6
4	9597.XP_003806186.1	0.693	Cytochrome c oxidase subunit 5B, mitochondrial
5	9597.XP_003828792.1	0.673	NADH:ubiquinone oxidoreductase core subunit S8
6	9597.XP_008964616.1	0.667	ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
7	9597.XP_003811885.1	0.662	NADH:ubiquinone oxidoreductase core subunit S2
8	9597.XP_008963888.1	0.655	NADH:ubiquinone oxidoreductase subunit A10
9	9597.XP_003807733.1	0.591	NADH:ubiquinone oxidoreductase subunit B10
10	9597.XP_003807126.1	0.588	NADH:ubiquinone oxidoreductase subunit B7
11	9597.XP_003813759.1	0.588	Carrier of the growing fatty acid chain in fatty acid biosynthesis
12	9597.XP_008955565.1	0.588	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 78 ESTs, 8 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments
13	9597.XP_003809373.1	0.582	NADH:ubiquinone oxidoreductase core subunit V2
14	9597.XP_008973889.1	0.582	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
15	9597.XP_003819762.1	0.551	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 102 ESTs, 3 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments, including 15 samples with support for all annotated introns
16	9597.XP_003814812.1	0.545	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 15 ESTs, 4 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
17	9597.XP_003820896.1	0.545	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 644 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
18	9597.XP_008955225.1	0.545	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
19	9597.XP_003824488.1	0.532	ATP synthase F(0) complex subunit B1, mitochondrial
20	9597.XP_008961266.1	0.532	ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008028	0.998	monocarboxylic acid transmembrane transporter activity
GO:1901702	0.997	salt transmembrane transporter activity
GO:0050833	0.956	pyruvate transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.958	cellular process
GO:0071704	0.932	organic substance metabolic process
GO:0044237	0.924	cellular metabolic process
GO:0044281	0.888	small molecule metabolic process
GO:0019752	0.669	carboxylic acid metabolic process
GO:0055085	0.573	transmembrane transport
GO:0044238	0.451	primary metabolic process
GO:1903825	0.429	organic acid transmembrane transport
GO:1990542	0.422	mitochondrial transmembrane transport
GO:0015718	0.419	monocarboxylic acid transport
GO:1905039	0.394	carboxylic acid transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.982	membrane
GO:0005740	0.956	mitochondrial envelope
GO:0031966	0.954	mitochondrial membrane
GO:0005743	0.925	mitochondrial inner membrane
GO:0032991	0.331	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]