StarFunc result for job id P0DKV0

User Input

>input (1188 residues)
MENLPFPLKLLSASSLNTPSSTPWVLDIFLTLVFALGLFFLLLPYFSYLRCDNPPSPSPR
KRKRHLVSQRHLVSQCPTGRRGRPRGRMKNHSLRACRECPRGLEETWDLLSQLQSLLGPH
LEKGDFGQLSGPDPPGEVGKRTPDGASRSSHEPMEDAAPIVSPLASPDPRTKHPQDLAST
PPPGPMTTSVSSLSASQPPEPSLLLERPSPEPPALFPHPPHTPDPLACSPPPPKGFTPPP
LRDSTLLTPSHCDSVALPLDTVPQSLSPREDLAASVPAISGLGGSNSQVSALSWSQETTK
TWCIFNSSVQQDHLSRQRDTTMSPLLFQAQPLSHLGPESQPFISSTPQFRPTPMAQAEAQ
AHLQSSFPVLSPAFLSPMKNTGVACPASQNKVQALSLPETQHPERPLLRKQLEGGLALPS
RVQKSQDVFSVSTPNLPQERLTSILPENFPVSPELWRQLEQYMGQRGRIQESLDLMQLQD
ELPGTSQAKGKPRPWQSSTSTGESSKEAQTVKFQLERDPCPHLGQILGETPQNLSRGMES
FPGKVLGATSEESERNLRKPLRSDSGSDLLRRTERNHIENILKAHMGRKLGQTNEGLIPV
SVRRSWLAVNQAFPVSNTHVKTSNLAAPKSRKACVNTAQVLSFLELCTQQVLEAHIVRFW
AKHRWGLPLRVLKPIQCFQLEKVSSLSLIQLAGPSSDTCESGAGSKVEVATLLGEPPMAS
LRKQVLTKPSVHMPERLQASSPACKQFQRAPRGIPSSNDHGSLKAPTAGQEGRWPSKPLT
YSLKGSTQQSRSLGAQSSRAGETREAVPQPTVPLGTCMRANLQATSEDVRGFKAPGASKS
SLLPRMSVSQDPRKLCLMEEAVSEFEPGMATKSETQPQVSAAVVLLPDGQASVVPHASEN
LASQVPQGHLQSTPTGNMQASQELCDLMSARRSNMGHKEPRNPNCQGSCKSQSPMFPPTH
KRENSRKPNLEKHEEMFQGLRTPQLTPGRKTEDTRQNEGVQLLPSKKQPPSISHFGENIK
QFFETIFSKKERKPAPVTAESQKTVKNRSCVYGSSAEAERLMTAVGQIPEENMSLCHARH
ASKVNQQRQQFQAPVCGFPCNHRHPFYSDHSRMLSYAASSQQATLKNQSRPNRDRQIRDQ
QPLKSVRCNNEQWGLRHPQLLLPKKAVSPVSPPQHRPKTPSASSHHHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWB4	0.089	0.081	0.000	1347	0.860	0.759	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	AFDB:B6VQA5	0.079	0.088	7.601E-31	1048	0.290	0.329	B6VQA5.pdb.gz	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
3	AFDB:A5PL33	0.032	0.036	1.740E-3	1030	0.162	0.186	A5PL33.pdb.gz	KRBA1_HUMAN Protein KRBA1 OS=Homo sapiens OX=9606 GN=KRBA1 PE=1 SV=3
4	AFDB:Q63624	0.047	0.045	2.644E-3	1258	0.155	0.146	Q63624.pdb.gz	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
5	AFDB:Q21127	0.041	0.056	8.657E-3	819	0.117	0.170	Q21127.pdb.gz	MEGG2_CAEEL Protein meg-2 OS=Caenorhabditis elegans OX=6239 GN=meg-2 PE=1 SV=2
6	AFDB:Q09MP3	0.040	0.041	1.227E-2	1159	0.133	0.136	Q09MP3.pdb.gz	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
7	AFDB:Q6FWW3	0.044	0.049	1.411E-2	990	0.122	0.146	Q6FWW3.pdb.gz	ZRG8_CANGA Zinc-regulated protein 8 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ZRG8 PE=3 SV=1
8	AFDB:Q90ZW5	0.055	0.053	2.000E-2	1261	0.158	0.149	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
9	AFDB:Q95RC8	0.041	0.038	2.465E-2	1280	0.125	0.116	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
10	AFDB:Q9W705	0.043	0.036	2.643E-2	1516	0.149	0.117	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
11	PDB:5nrlG	0.034	0.073	1.375	372	0.019	0.059	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
12	PDB:7vhpG	0.033	0.093	4.500	299	0.013	0.050	7vhpG.pdb.gz
13	PDB:6ahd9	0.031	0.170	5.548	165	0.016	0.115	6ahd9.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
14	PDB:6yxxAI	0.026	0.091	9.041	240	0.010	0.050	6yxxAI.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWB4	0.0	1474	1347	0.635	0.560	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	B6VQA5	2.05e-104	356	1048	0.258	0.293	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
3	G3X912	0.21	38.1	497	0.027	0.064	SPRTN_MOUSE DNA-dependent metalloprotease SPRTN OS=Mus musculus OX=10090 GN=Sprtn PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15371 DUF4599	1.4e-20	84.7	Domain of unknown function (DUF4599)
2	PF14650 FAM75	9.4e-88	306.9	FAM75 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008973981.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806584.1	0.510	Spermatogenesis-associated protein 32 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003779	0.353	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.678	regulation of biological process
GO:0009987	0.573	cellular process
GO:0071704	0.438	organic substance metabolic process
GO:0044238	0.363	primary metabolic process
GO:0032502	0.332	developmental process
GO:0032501	0.330	multicellular organismal process
GO:0050794	0.303	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0012505	0.993	endomembrane system
GO:0031410	0.981	cytoplasmic vesicle
GO:0099503	0.945	secretory vesicle
GO:0030141	0.913	secretory granule
GO:0001669	0.846	acrosomal vesicle
GO:0005634	0.349	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]