StarFunc result for job id P0DKX0

User Input

>input (622 residues)
MGSLTFRDVAIQFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAPKPDLIIFLEQGK
EPWNMKRHELVKEPPVICSHFAQDLWPEQGREDSFQKVILRRYEKCGHENLQLKIGCTNV
DECKVHKKGYNKLNQSLTTTQSKVFQCGKYANIFHKCSNSKRHKIRHTGKKLLKCKEYVR
SFCMLSHLSQHKRIYTRENSYKSEEHGKAFNWSSALTYKRIHTGEKPCKCEECGKAFSKF
SILTKHKVIHTGEKHYKCEECGKAFTRSSSLIEHKRSHAGEKPYKCEECGKAFSKASTLT
AHKTIHAGEKPYKCEECGKAFNRSSNLMEHKRIHTGEKPCKCEECGKAFGNFSTLTKHKV
IHTGEKPYKCEECGKAFSWPSSLTEHKRIHAGDKPYKCEECGKTFKWSSTLTKHKIIHTG
EKPYKCEECGKAFTTFSSLTKHKVIHTGEKHYKCEECGKVFSWSSSLTTHKAIHAGEKLY
KCEECGKAFKWSSNLMEHKRIHTGEKPYKCEECGKAFSKVANLTKHKVIHTGEKQYKCEE
CGKAFIWSSRLSEHKRIHTGEKPYKCEECGKAFSWVSVLNKHKKIHAGKKFYKCEECGKD
FNQSSHLTTHKRIHTGGKTLQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NNF4	0.493	0.425	3.187E-72	738	0.730	0.615	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	AFDB:Q05481	0.341	0.215	3.687E-70	1191	0.719	0.375	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
3	AFDB:P35789	0.475	0.476	1.897E-69	620	0.688	0.690	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
4	AFDB:O75437	0.509	0.484	1.511E-68	659	0.715	0.675	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
5	AFDB:Q03923	0.494	0.515	4.002E-67	595	0.658	0.687	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	AFDB:P17038	0.391	0.315	2.991E-65	809	0.709	0.545	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
7	AFDB:Q03936	0.488	0.515	1.813E-64	586	0.609	0.647	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
8	AFDB:Q8IYB9	0.475	0.460	3.102E-63	648	0.622	0.597	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
9	AFDB:Q14593	0.382	0.412	1.686E-62	569	0.593	0.649	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
10	AFDB:Q8TD23	0.405	0.438	1.498E-61	568	0.621	0.680	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
11	PDB:3w5kB	0.083	0.277	3.648E-4	110	0.061	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6iczL	0.064	0.073	1.118	454	0.090	0.123	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:6id0L	0.068	0.084	1.118	475	0.098	0.128	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:6gejS	0.045	0.101	1.730	208	0.066	0.197	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
15	PDB:7ungi	0.040	0.084	1.929	250	0.051	0.128	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7ajuCK	0.049	0.105	2.038	222	0.058	0.162	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:2p01A	0.066	0.095	2.400	323	0.063	0.121	2p01A.pdb.gz
18	PDB:4zzlA	0.068	0.170	2.400	146	0.032	0.137	4zzlA.pdb.gz
19	PDB:5dgeSM	0.047	0.156	2.535	159	0.037	0.145	5dgeSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
20	PDB:5datSM	0.048	0.147	2.986	159	0.032	0.126	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	885	616	0.730	0.737	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	A8K8Y5	532	707	0.469	0.413	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
3	O75290	552	641	0.465	0.451	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
4	O75437	858	659	0.717	0.677	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
5	P17038	565	809	0.497	0.382	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
6	P35789	843	620	0.690	0.692	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
7	P51523	539	738	0.484	0.408	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	P52742	540	658	0.484	0.457	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	Q02386	548	682	0.506	0.462	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
10	Q03923	809	595	0.677	0.708	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
11	Q03936	788	586	0.658	0.698	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
12	Q05481	597	1191	0.524	0.274	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
13	Q14593	746	569	0.606	0.663	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
14	Q15928	582	474	0.489	0.641	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
15	Q2NKJ9	748	569	0.609	0.666	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
16	Q3V1X2	558	888	0.516	0.361	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
17	Q49A12	681	536	0.580	0.674	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
18	Q5DTF8	559	919	0.518	0.350	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
19	Q5JVG8	577	444	0.458	0.642	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
20	Q5MCW4	544	686	0.511	0.464	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	29	16.3	TFIIH C1-like domain
2	PF12552 DUF3741	6.7	18.0	Protein of unknown function (DUF3741)
3	PF19561 DUF6083	1.3e+02	13.8	Family of unknown function (DUF6083)
4	PF07754 HVO_2753_ZBP	8.5	17.6	Small zinc finger protein HVO_2753-like, Zn-binding pocket
5	PF01352 KRAB	4.2e-20	82.4	KRAB box
6	PF10484 MRP-S23	9.6	17.9	Mitochondrial ribosomal protein S23
7	PF16919 PknG_rubred	8.9e+02	11.4	Protein kinase G rubredoxin domain
8	PF01286 XPA_N	6.3e-14	63.0	XPA protein N-terminal
9	PF00096 zf-C2H2	9e-62	213.4	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	1.3e-18	77.7	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	1.2e-29	111.4	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	1.1e-33	125.7	C2H2-type zinc finger
13	PF15909 zf-C2H2_8	5.7e-05	34.7	C2H2-type zinc ribbon
14	PF12171 zf-C2H2_jaz	5.7e-17	72.8	Zinc-finger double-stranded RNA-binding
15	PF13465 zf-H2C2_2	4.5e-98	329.0	Zinc-finger double domain
16	PF02591 zf-RING_7	2e-07	42.4	C4-type zinc ribbon domain
17	PF13451 zf-trcl	8.4e-07	40.1	Probable zinc-ribbon domain
18	PF18439 zf_UBZ	7e-15	65.7	Ubiquitin-Binding Zinc Finger
19	PF17032 zinc_ribbon_15	2.8	20.1	zinc-ribbon family
20	PF09723 Zn-ribbon_8	1.2e-14	65.4	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471593

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000423505	0.611	Tetratricopeptide repeat domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.993	regulation of gene expression
GO:0051252	0.993	regulation of RNA metabolic process
GO:0009889	0.979	regulation of biosynthetic process
GO:0006355	0.974	regulation of DNA-templated transcription
GO:0009892	0.850	negative regulation of metabolic process
GO:0009890	0.826	negative regulation of biosynthetic process
GO:0051172	0.796	negative regulation of nitrogen compound metabolic process
GO:0048523	0.790	negative regulation of cellular process
GO:0010605	0.785	negative regulation of macromolecule metabolic process
GO:0031324	0.779	negative regulation of cellular metabolic process
GO:1902679	0.739	negative regulation of RNA biosynthetic process
GO:0045892	0.702	negative regulation of DNA-templated transcription
GO:0009987	0.631	cellular process
GO:0008152	0.312	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.986	nucleoplasm
GO:0005737	0.827	cytoplasm
GO:0043232	0.373	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]