StarFunc result for job id P0DMB1

User Input

>input (279 residues)
MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLN
SYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPE
HVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQ
PLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGME
LLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PI22	0.399	0.399	2.046E-42	279	1.000	1.000	E9PI22.pdb.gz	P23D1_HUMAN Proline-rich protein 23D1 OS=Homo sapiens OX=9606 GN=PRR23D1 PE=1 SV=1
2	AFDB:Q0V865	0.078	0.065	4.665E-1	463	0.122	0.073	Q0V865.pdb.gz	FAFL_ARATH Protein FAF-like, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g22090 PE=2 SV=1
3	PDB:7pmxA	0.076	0.036	1.143	657	0.025	0.011	7pmxA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.
4	PDB:2bq8X	0.069	0.065	1.467	304	0.025	0.023	2bq8X.pdb.gz	Crystal Structures of Recombinant Human Purple Acid Phosphatase with and without an Inhibitory Conformation of the Repression Loop.
5	PDB:3kgdB	0.073	0.065	1.467	342	0.050	0.041	3kgdB.pdb.gz	Structure of the RNA 3'-phosphate cyclase-adenylate intermediate illuminates nucleotide specificity and covalent nucleotidyl transfer.
6	PDB:8apaM1	0.051	0.058	1.768	234	0.039	0.047	8apaM1.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
7	AFDB:Q5FW52	0.090	0.093	1.954	269	0.176	0.182	Q5FW52.pdb.gz	MLIP_MOUSE Muscular LMNA-interacting protein OS=Mus musculus OX=10090 GN=Mlip PE=1 SV=2
8	PDB:6aa3A	0.080	0.115	2.268	162	0.039	0.068	6aa3A.pdb.gz	Discovery of a new class of MTH1 inhibitor by X-ray crystallographic screening.
9	PDB:6msoA	0.099	0.057	2.268	540	0.032	0.017	6msoA.pdb.gz	Crystal Structures of Fumarate Hydratases from Leishmania major in a Complex with Inhibitor 2-Thiomalate.
10	PDB:4ga6A	0.076	0.047	2.414	493	0.032	0.018	4ga6A.pdb.gz	Structure analysis of archaeal AMP phosphorylase reveals two unique modes of dimerization
11	PDB:7rr9A	0.086	0.049	2.414	560	0.025	0.013	7rr9A.pdb.gz	Structures of the human peroxisomal fatty acid transporter ABCD1 in a lipid environment
12	PDB:1uptG	0.111	0.164	2.569	170	0.032	0.053	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
13	PDB:4hpqB	0.075	0.140	2.734	115	0.025	0.061	4hpqB.pdb.gz
14	AFDB:Q3UNH4	0.085	0.036	4.126	932	0.222	0.067	Q3UNH4.pdb.gz	GRIN1_MOUSE G protein-regulated inducer of neurite outgrowth 1 OS=Mus musculus OX=10090 GN=Gprin1 PE=1 SV=2
15	AFDB:Q54NE5	0.085	0.023	4.391	1918	0.104	0.015	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
16	AFDB:Q3UG20	0.074	0.022	5.293	1868	0.211	0.032	Q3UG20.pdb.gz	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
17	AFDB:Q6ZJU3	0.112	0.085	6.381	427	0.147	0.096	Q6ZJU3.pdb.gz	TIF6A_ORYSJ Protein TIFY 6a OS=Oryza sativa subsp. japonica OX=39947 GN=TIFY6A PE=1 SV=1
18	AFDB:Q9W7R4	0.074	0.014	7.692	2694	0.158	0.016	Q9W7R4.pdb.gz	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
19	AFDB:G3XKQ9	0.083	0.069	8.186	394	0.165	0.117	G3XKQ9.pdb.gz	LAX2_ORYSJ Protein LAX PANICLE 2 OS=Oryza sativa subsp. japonica OX=39947 GN=LAX2 PE=1 SV=1
20	AFDB:Q0E8J0	0.094	0.034	9.272	1152	0.165	0.040	Q0E8J0.pdb.gz	Q0E8J0_DROME MEP-1, isoform A OS=Drosophila melanogaster OX=7227 GN=MEP-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PI22	0.0	564	279	1.000	1.000	P23D1_HUMAN Proline-rich protein 23D1 OS=Homo sapiens OX=9606 GN=PRR23D1 PE=1 SV=1
2	Q6ZRT6	3.29e-05	46.6	265	0.247	0.260	PR23B_HUMAN Proline-rich protein 23B OS=Homo sapiens OX=9606 GN=PRR23B PE=1 SV=1
3	Q4JDL3	0.75	33.5	420	0.079	0.052	PTN20_HUMAN Tyrosine-protein phosphatase non-receptor type 20 OS=Homo sapiens OX=9606 GN=PTPN20 PE=1 SV=1
4	D6RC68	1.2	30.4	68	0.079	0.324	D6RC68_HUMAN Protein tyrosine phosphatase non-receptor type 20 (Fragment) OS=Homo sapiens OX=9606 GN=PTPN20 PE=4 SV=1
5	Q86G90	3.1	32.0	884	0.090	0.028	Q86G90_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=1
6	Q21021	3.2	32.0	860	0.090	0.029	Q21021_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=2
7	Q8UGL3	3.4	31.2	294	0.068	0.065	DAPA_AGRFC 4-hydroxy-tetrahydrodipicolinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=dapA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10630 DUF2476	2.4e-12	59.2	Protein of unknown function (DUF2476)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436580	0.771	Proline rich 23 domain containing 2
2	9606.ENSP00000334681	0.683	Defensin, beta 107A
3	9606.ENSP00000347810	0.681	Beta-defensin 107
4	9606.ENSP00000334364	0.619	Defensin, beta 106B
5	9606.ENSP00000335307	0.619	Beta-defensin 106
6	9606.ENSP00000485243	0.519	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4
7	9606.ENSP00000485306	0.505	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0065007	0.690	biological regulation
GO:0050789	0.675	regulation of biological process
GO:0050794	0.668	regulation of cellular process
GO:0022414	0.511	reproductive process
GO:0140013	0.355	meiotic nuclear division
GO:0048522	0.346	positive regulation of cellular process
GO:0019219	0.342	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.342	positive regulation of cellular metabolic process
GO:0003006	0.340	developmental process involved in reproduction
GO:0051173	0.340	positive regulation of nitrogen compound metabolic process
GO:0010604	0.340	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.939	intracellular organelle lumen
GO:0031981	0.795	nuclear lumen
GO:0005654	0.674	nucleoplasm
GO:0043228	0.517	non-membrane-bounded organelle
GO:0043232	0.485	intracellular non-membrane-bounded organelle
GO:0005737	0.359	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]