StarFunc result for job id P0DMC3

User Input

>input (54 residues)
MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DMC3	1.000	1.000	8.645E-8	54	1.000	1.000	P0DMC3.pdb.gz	ELA_HUMAN Apelin receptor early endogenous ligand OS=Homo sapiens OX=9606 GN=APELA PE=1 SV=1
2	AFDB:P70354	0.357	0.112	6.077	204	0.111	0.029	P70354.pdb.gz	MSX3_MOUSE Homeobox protein MSX-3 OS=Mus musculus OX=10090 GN=Msx3 PE=1 SV=1
3	AFDB:F8WAY7	0.337	0.342	7.811	53	0.185	0.189	F8WAY7.pdb.gz	F8WAY7_HUMAN Protein mono-ADP-ribosyltransferase PARP3 OS=Homo sapiens OX=9606 GN=PARP3 PE=4 SV=1
4	AFDB:P13207	0.373	0.133	8.492	167	0.093	0.030	P13207.pdb.gz	EDN3_RAT Endothelin-3 OS=Rattus norvegicus OX=10116 GN=Edn3 PE=2 SV=3
5	AFDB:Q9VAT0	0.340	0.046	8.492	527	0.111	0.011	Q9VAT0.pdb.gz	Q9VAT0_DROME RE12101p OS=Drosophila melanogaster OX=7227 GN=WASp PE=1 SV=1
6	AFDB:O54697	0.414	0.039	9.233	745	0.148	0.011	O54697.pdb.gz	NALDL_RAT Aminopeptidase NAALADL1 OS=Rattus norvegicus OX=10116 GN=Naaladl1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DMC3	1.02e-32	107	54	1.000	1.000	ELA_HUMAN Apelin receptor early endogenous ligand OS=Homo sapiens OX=9606 GN=APELA PE=1 SV=1
2	P0DMC4	1.42e-20	77.4	54	0.685	0.685	ELA_MOUSE Apelin receptor early endogenous ligand OS=Mus musculus OX=10090 GN=Apela PE=1 SV=1
3	P0DP76	1.21e-17	70.1	54	0.611	0.611	ELA_RAT Apelin receptor early endogenous ligand OS=Rattus norvegicus OX=10116 GN=Apela PE=3 SV=1
4	P0DMC2	3.11e-08	46.2	58	0.352	0.328	ELA_DANRE Apelin receptor early endogenous ligand OS=Danio rerio OX=7955 GN=apela PE=1 SV=1
5	B7SEE0	1.0	28.1	426	0.222	0.028	B7SEE0_DANRE Interferon regulatory factor 3 OS=Danio rerio OX=7955 GN=irf3 PE=1 SV=1
6	Q9HCF6	2.1	27.3	1732	0.259	0.008	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
7	O07208	4.1	26.6	324	0.185	0.031	O07208_MYCTO Transmembrane alanine and leucine rich protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2780 PE=4 SV=1
8	G0SAK8	5.7	26.2	1170	0.259	0.012	PAN2_CHATD PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=PAN2 PE=1 SV=1
9	P33334	9.1	25.8	2413	0.148	0.003	PRP8_YEAST Pre-mRNA-splicing factor 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484618

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000475344	0.988	Apelin receptor
2	9606.ENSP00000391800	0.760	Apelin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity
GO:0031704	0.995	apelin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0051239	0.982	regulation of multicellular organismal process
GO:0009966	0.971	regulation of signal transduction
GO:0050896	0.967	response to stimulus
GO:0007165	0.951	signal transduction
GO:0048522	0.945	positive regulation of cellular process
GO:0051050	0.933	positive regulation of transport
GO:0007186	0.930	G protein-coupled receptor signaling pathway
GO:0051240	0.925	positive regulation of multicellular organismal process
GO:0051094	0.905	positive regulation of developmental process
GO:0045766	0.896	positive regulation of angiogenesis
GO:0051130	0.451	positive regulation of cellular component organization
GO:2000241	0.418	regulation of reproductive process
GO:1902531	0.379	regulation of intracellular signal transduction
GO:2000243	0.352	positive regulation of reproductive process
GO:0048260	0.300	positive regulation of receptor-mediated endocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0043231	0.481	intracellular membrane-bounded organelle
GO:0005886	0.475	plasma membrane
GO:0005737	0.435	cytoplasm
GO:0005615	0.415	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]