StarFunc result for job id P0DME0

User Input

>input (302 residues)
MVWFLDFPNSMAPKRQSPLPLQKKKPRPPPALGLEETSASAGLPKKGEKEQQEAIEHIDE
VQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLG
EEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTK
IKWKSGKDVTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPL
QYYLVPDMDDEEGGEDDDDDDDDGDEGEEELEDIDEGDEDEGEEDEDDDEGEEGEEDEGE
DD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DME0	1.000	1.000	2.373E-51	302	1.000	1.000	P0DME0.pdb.gz	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
2	AFDB:Q63945	0.738	0.769	2.226E-41	289	0.861	0.900	Q63945.pdb.gz	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
3	AFDB:A0A2R8QJ70	0.682	0.716	5.570E-36	287	0.719	0.756	A0A2R8QJ70.pdb.gz
4	AFDB:Q8LC68	0.633	0.744	4.617E-21	255	0.311	0.369	Q8LC68.pdb.gz	NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=NRP2 PE=1 SV=2
5	AFDB:Q9CA59	0.565	0.660	1.670E-20	256	0.325	0.383	Q9CA59.pdb.gz	NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=NRP1 PE=1 SV=1
6	AFDB:Q9H2G4	0.575	0.255	1.934E-19	693	0.258	0.113	Q9H2G4.pdb.gz	TSYL2_HUMAN Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1
7	AFDB:Q7JMA9	0.556	0.537	2.627E-19	313	0.344	0.332	Q7JMA9.pdb.gz	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1
8	AFDB:Q86VY4	0.590	0.436	3.568E-19	417	0.288	0.209	Q86VY4.pdb.gz	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
9	AFDB:Q6FI91	0.548	0.390	1.214E-18	438	0.265	0.183	Q6FI91.pdb.gz	Q6FI91_HUMAN TSPYL protein OS=Homo sapiens OX=9606 GN=TSPYL PE=1 SV=1
10	AFDB:Q9UJ04	0.528	0.397	5.278E-18	414	0.255	0.186	Q9UJ04.pdb.gz	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
11	PDB:7c7xE	0.524	0.890	2.858E-16	174	0.258	0.448	7c7xE.pdb.gz
12	PDB:5gpkB	0.448	0.630	1.008E-11	207	0.159	0.232	5gpkB.pdb.gz
13	PDB:3fs3A	0.487	0.731	1.139E-11	197	0.182	0.279	3fs3A.pdb.gz
14	PDB:6k09A	0.479	0.533	1.905E-10	267	0.169	0.191	6k09A.pdb.gz
15	PDB:7un6B	0.476	0.585	6.483E-10	240	0.182	0.229	7un6B.pdb.gz
16	PDB:6n2gA	0.478	0.504	1.624E-9	285	0.175	0.186	6n2gA.pdb.gz
17	PDB:2ayuA	0.476	0.504	4.327E-9	283	0.195	0.208	2ayuA.pdb.gz
18	PDB:3q66A	0.469	0.581	1.084E-8	236	0.159	0.203	3q66A.pdb.gz
19	PDB:6baqF	0.089	0.113	4.111E-1	211	0.040	0.057	6baqF.pdb.gz
20	PDB:7bxtM	0.114	0.162	4.940E-1	198	0.026	0.040	7bxtM.pdb.gz	Cryo-EM structure of the CENP-A nucleosome in complex with phosphorylated CENP-C.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DME0	0.0	602	302	1.000	1.000	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
2	Q01105	1.55e-152	430	290	0.748	0.779	SET_HUMAN Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3
3	Q5VXV3	1.55e-152	430	290	0.748	0.779	Q5VXV3_HUMAN SET OS=Homo sapiens OX=9606 GN=SET PE=2 SV=1
4	Q9EQU5	1.86e-152	430	289	0.712	0.744	SET_MOUSE Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 SV=1
5	Q63945	3.63e-152	429	289	0.712	0.744	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
6	Q6TGU0	9.57e-137	389	275	0.629	0.691	Q6TGU0_DANRE Myeloid leukemia-associated SET translocation protein OS=Danio rerio OX=7955 GN=SET PE=1 SV=1
7	Q8LC68	2.32e-49	166	255	0.275	0.325	NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=NRP2 PE=1 SV=2
8	Q86VY4	3.69e-47	165	417	0.281	0.204	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
9	Q9H0U9	1.73e-45	161	437	0.235	0.162	TSYL1_HUMAN Testis-specific Y-encoded-like protein 1 OS=Homo sapiens OX=9606 GN=TSPYL1 PE=1 SV=3
10	Q6FI91	2.74e-45	160	438	0.235	0.162	Q6FI91_HUMAN TSPYL protein OS=Homo sapiens OX=9606 GN=TSPYL PE=1 SV=1
11	Q9H2G4	3.71e-44	161	693	0.242	0.105	TSYL2_HUMAN Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1
12	Q9UJ04	4.86e-44	157	414	0.238	0.174	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
13	Q18240	5.65e-44	154	312	0.281	0.272	SPR2_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=2 SV=2
14	Q7JMA9	1.31e-43	153	313	0.278	0.268	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1
15	Q9CA59	5.87e-43	150	256	0.308	0.363	NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=NRP1 PE=1 SV=1
16	Q8N831	1.13e-41	150	410	0.228	0.168	TSYL6_HUMAN Testis-specific Y-encoded-like protein 6 OS=Homo sapiens OX=9606 GN=TSPYL6 PE=1 SV=1
17	A6NKD2	1.17e-39	142	308	0.235	0.231	TSPY2_HUMAN Testis-specific Y-encoded protein 2 OS=Homo sapiens OX=9606 GN=TSPY2 PE=1 SV=1
18	P0CW01	1.50e-39	142	308	0.235	0.231	TSPYA_HUMAN Testis-specific Y-encoded protein 10 OS=Homo sapiens OX=9606 GN=TSPY10 PE=1 SV=2
19	Q01534	7.73e-39	140	308	0.235	0.231	TSPY1_HUMAN Testis-specific Y-encoded protein 1 OS=Homo sapiens OX=9606 GN=TSPY1 PE=1 SV=4
20	Q9R1M3	2.05e-34	129	334	0.222	0.201	TSPY1_RAT Testis-specific Y-encoded protein 1 OS=Rattus norvegicus OX=10116 GN=Tspy1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07374 DUF1492	5.2e+02	12.2	Protein of unknown function (DUF1492)
2	PF00956 NAP	1.9e-28	111.0	Nucleosome assembly protein (NAP)
3	PF16517 Nore1-SARAH	40	15.4	Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482245	0.716	Dachshund homolog 1
2	9606.ENSP00000357858	0.673	Mitotic checkpoint protein BUB3
3	9606.ENSP00000370376	0.650	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
4	9606.ENSP00000368458	0.646	Proliferating cell nuclear antigen
5	9606.ENSP00000362937	0.641	Regulator of chromosome condensation
6	9606.ENSP00000296417	0.632	Histone H2A.Z
7	9606.ENSP00000308405	0.632	Histone H2A.V
8	9606.ENSP00000246548	0.558	SUMO-activating enzyme subunit 2
9	9606.ENSP00000378699	0.538	Cyclin-dependent kinase 1
10	9606.ENSP00000362649	0.526	Histone deacetylase 1
11	9606.ENSP00000430432	0.526	Histone deacetylase 2
12	9606.ENSP00000376946	0.522	Bardet-Biedl syndrome 10 protein
13	9606.ENSP00000240922	0.516	N-alpha-acetyltransferase 50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0042393	0.439	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0019222	0.981	regulation of metabolic process
GO:0080090	0.952	regulation of primary metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0050794	0.926	regulation of cellular process
GO:0071704	0.860	organic substance metabolic process
GO:0044238	0.858	primary metabolic process
GO:0031323	0.801	regulation of cellular metabolic process
GO:0006807	0.800	nitrogen compound metabolic process
GO:0009888	0.794	tissue development
GO:0043170	0.721	macromolecule metabolic process
GO:0009889	0.713	regulation of biosynthetic process
GO:0019219	0.712	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.633	cellular metabolic process
GO:0010468	0.623	regulation of gene expression
GO:0071840	0.607	cellular component organization or biogenesis
GO:0010556	0.605	regulation of macromolecule biosynthetic process
GO:0016043	0.562	cellular component organization
GO:0031326	0.521	regulation of cellular biosynthetic process
GO:0048518	0.520	positive regulation of biological process
GO:0051252	0.517	regulation of RNA metabolic process
GO:2001141	0.508	regulation of RNA biosynthetic process
GO:0009893	0.491	positive regulation of metabolic process
GO:0006355	0.468	regulation of DNA-templated transcription
GO:0051173	0.464	positive regulation of nitrogen compound metabolic process
GO:0048522	0.461	positive regulation of cellular process
GO:0010604	0.455	positive regulation of macromolecule metabolic process
GO:0048519	0.438	negative regulation of biological process
GO:0031325	0.429	positive regulation of cellular metabolic process
GO:1901360	0.416	organic cyclic compound metabolic process
GO:0006139	0.399	nucleobase-containing compound metabolic process
GO:0010557	0.379	positive regulation of macromolecule biosynthetic process
GO:0031328	0.375	positive regulation of cellular biosynthetic process
GO:0090304	0.369	nucleic acid metabolic process
GO:0045944	0.366	positive regulation of transcription by RNA polymerase II
GO:0022607	0.301	cellular component assembly
GO:0006338	0.301	chromatin remodeling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005737	0.984	cytoplasm
GO:0005811	0.981	lipid droplet
GO:0032991	0.716	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]