StarFunc result for job id P0DML2

User Input

>input (217 residues)
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DML2	1.000	1.000	1.706E-29	217	1.000	1.000	P0DML2.pdb.gz	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
2	AFDB:P01241	0.896	0.896	1.210E-22	217	0.853	0.853	P01241.pdb.gz	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
3	PDB:1z7cA	0.696	0.928	3.122E-16	161	0.733	0.988	1z7cA.pdb.gz
4	AFDB:P01244	0.792	0.796	4.825E-16	216	0.599	0.602	P01244.pdb.gz	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
5	AFDB:A0FJ27	0.774	0.774	2.463E-15	217	0.613	0.613	A0FJ27.pdb.gz	A0FJ27_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
6	PDB:1bp3A	0.704	0.812	7.756E-15	186	0.724	0.844	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
7	AFDB:H6ULW9	0.780	0.783	2.233E-13	216	0.479	0.481	H6ULW9.pdb.gz	H6ULW9_CHICK Growth hormone OS=Gallus gallus OX=9031 GN=GH PE=3 SV=1
8	PDB:1huwA	0.637	0.815	6.387E-13	166	0.590	0.771	1huwA.pdb.gz
9	AFDB:B2Z9Z2	0.685	0.706	1.511E-7	210	0.323	0.333	B2Z9Z2.pdb.gz	B2Z9Z2_SALSA Growth hormone 2 OS=Salmo salar OX=8030 GN=LOC106607462 PE=3 SV=1
10	AFDB:A7LFX3	0.632	0.679	2.326E-7	200	0.341	0.370	A7LFX3.pdb.gz	A7LFX3_ICTPU Growth hormone OS=Ictalurus punctatus OX=7998 GN=gh1 PE=2 SV=1
11	AFDB:P01238	0.673	0.640	9.801E-7	229	0.258	0.245	P01238.pdb.gz	PRL_PIG Prolactin OS=Sus scrofa OX=9823 GN=PRL PE=1 SV=3
12	AFDB:W5PH94	0.646	0.610	1.246E-6	231	0.281	0.264	W5PH94.pdb.gz	W5PH94_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=3 SV=1
13	AFDB:A3FEU9	0.692	0.732	1.509E-6	204	0.267	0.284	A3FEU9.pdb.gz	A3FEU9_9CICH Somatotropin OS=Oreochromis urolepis hornorum OX=161276 PE=2 SV=1
14	PDB:1f6fA	0.621	0.725	1.073E-5	183	0.212	0.251	1f6fA.pdb.gz
15	PDB:3d48P	0.634	0.812	6.031E-5	165	0.194	0.255	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
16	PDB:1rw5A	0.597	0.646	1.238E-4	199	0.194	0.211	1rw5A.pdb.gz
17	PDB:7u7nD	0.426	0.473	1.425E-1	191	0.134	0.152	7u7nD.pdb.gz
18	PDB:7zxkC	0.381	0.487	1.899E-1	166	0.129	0.169	7zxkC.pdb.gz
19	PDB:6o4oA	0.444	0.542	2.301E-1	169	0.097	0.124	6o4oA.pdb.gz
20	PDB:3pivB	0.339	0.430	2.924E-1	157	0.083	0.115	3pivB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DML2	5.49e-164	452	217	1.000	1.000	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
2	P0DML3	6.63e-163	449	217	0.995	0.995	CSH2_HUMAN Chorionic somatomammotropin hormone 2 OS=Homo sapiens OX=9606 GN=CSH2 PE=1 SV=1
3	P01241	7.60e-121	343	217	0.853	0.853	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
4	P01242	7.62e-109	313	217	0.797	0.797	SOM2_HUMAN Growth hormone variant OS=Homo sapiens OX=9606 GN=GH2 PE=1 SV=3
5	P01248	2.98e-86	256	216	0.627	0.630	SOMA_PIG Somatotropin OS=Sus scrofa OX=9823 GN=GH1 PE=1 SV=2
6	P06880	1.29e-83	249	216	0.604	0.606	SOMA_MOUSE Somatotropin OS=Mus musculus OX=10090 GN=Gh1 PE=2 SV=1
7	P01244	2.90e-82	246	216	0.599	0.602	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
8	G3CI04	4.44e-82	245	217	0.613	0.613	G3CI04_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
9	Q0QBC4	2.60e-78	236	217	0.599	0.599	Q0QBC4_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
10	B0FPG6	2.73e-75	228	217	0.627	0.627	B0FPG6_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH PE=2 SV=1
11	P01246	2.73e-75	228	217	0.627	0.627	SOMA_BOVIN Somatotropin OS=Bos taurus OX=9913 GN=GH1 PE=1 SV=1
12	Q95205	5.38e-75	227	204	0.571	0.608	Q95205_SHEEP Placental growth hormone (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
13	B0FPG4	5.80e-75	227	217	0.622	0.622	B0FPG4_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH1 PE=3 SV=1
14	Q0QBC6	4.83e-74	225	217	0.618	0.618	Q0QBC6_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
15	P08998	5.87e-74	224	216	0.553	0.556	SOMA_CHICK Somatotropin OS=Gallus gallus OX=9031 GN=GH PE=1 SV=2
16	A4GX95	6.48e-74	224	217	0.618	0.618	A4GX95_BOVIN Growth hormone OS=Bos taurus OX=9913 PE=2 SV=1
17	P67930	6.48e-74	224	217	0.618	0.618	SOMA_SHEEP Somatotropin OS=Ovis aries OX=9940 GN=GH1 PE=1 SV=1
18	Q71VP3	6.48e-74	224	217	0.618	0.618	Q71VP3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=2 SV=1
19	Q0QBF7	1.07e-73	224	217	0.618	0.618	Q0QBF7_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
20	Q0QBG3	1.39e-73	224	217	0.618	0.618	Q0QBG3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00103 Hormone_1	3.6e-59	211.7	Somatotropin hormone family
2	PF19307 PCLP	4.8e+02	11.1	Phage capsid-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376623	0.996	Chorionic somatomammotropin hormone 2
2	9606.ENSP00000482954	0.925	Prolactin receptor
3	9606.ENSP00000483403	0.916	Growth hormone receptor
4	9606.ENSP00000302150	0.905	Prolactin
5	9606.ENSP00000312652	0.893	Leptin
6	9606.ENSP00000312673	0.888	Somatotropin
7	9606.ENSP00000252723	0.833	Erythropoietin
8	9606.ENSP00000333157	0.831	Growth hormone 1 isoform 5
9	9606.ENSP00000215909	0.805	Galectin-1
10	9606.ENSP00000225474	0.805	Granulocyte colony-stimulating factor
11	9606.ENSP00000204615	0.800	Thrombopoietin
12	9606.ENSP00000355370	0.800	Ciliary neurotrophic factor
13	9606.ENSP00000300175	0.772	Neuroendocrine protein 7B2
14	9606.ENSP00000341208	0.750	Signal transducer and activator of transcription 5A
15	9606.ENSP00000293328	0.747	Signal transducer and activator of transcription 5B
16	9606.ENSP00000371067	0.736	Tyrosine-protein kinase JAK2
17	9606.ENSP00000380432	0.736	Insulin
18	9606.ENSP00000304895	0.708	Insulin receptor substrate 1
19	9606.ENSP00000482232	0.706	Glycoprotein hormones, alpha polypeptide
20	9606.ENSP00000365016	0.700	Insulin receptor substrate 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.995	signaling receptor binding
GO:0005126	0.946	cytokine receptor binding
GO:0098772	0.907	molecular function regulator activity
GO:0005131	0.897	growth hormone receptor binding
GO:0030546	0.885	signaling receptor activator activity
GO:0048018	0.874	receptor ligand activity
GO:0003824	0.323	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0048522	0.993	positive regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0009987	0.970	cellular process
GO:0019222	0.957	regulation of metabolic process
GO:0009893	0.950	positive regulation of metabolic process
GO:0051716	0.937	cellular response to stimulus
GO:0031323	0.919	regulation of cellular metabolic process
GO:0031325	0.895	positive regulation of cellular metabolic process
GO:0060255	0.867	regulation of macromolecule metabolic process
GO:0007154	0.864	cell communication
GO:0023052	0.863	signaling
GO:0007165	0.845	signal transduction
GO:0080090	0.826	regulation of primary metabolic process
GO:0051171	0.822	regulation of nitrogen compound metabolic process
GO:0044093	0.821	positive regulation of molecular function
GO:0051174	0.809	regulation of phosphorus metabolic process
GO:0001934	0.795	positive regulation of protein phosphorylation
GO:0034762	0.773	regulation of transmembrane transport
GO:0023051	0.740	regulation of signaling
GO:0051050	0.726	positive regulation of transport
GO:0034764	0.713	positive regulation of transmembrane transport
GO:0010646	0.705	regulation of cell communication
GO:0050730	0.702	regulation of peptidyl-tyrosine phosphorylation
GO:0023056	0.686	positive regulation of signaling
GO:0010647	0.686	positive regulation of cell communication
GO:0009966	0.665	regulation of signal transduction
GO:0048584	0.655	positive regulation of response to stimulus
GO:0009967	0.646	positive regulation of signal transduction
GO:0050731	0.646	positive regulation of peptidyl-tyrosine phosphorylation
GO:0007166	0.636	cell surface receptor signaling pathway
GO:0042221	0.623	response to chemical
GO:0010033	0.610	response to organic substance
GO:0009628	0.579	response to abiotic stimulus
GO:0032501	0.537	multicellular organismal process
GO:0071310	0.489	cellular response to organic substance
GO:0042127	0.446	regulation of cell population proliferation
GO:0032502	0.439	developmental process
GO:0048856	0.432	anatomical structure development
GO:0048519	0.424	negative regulation of biological process
GO:0009719	0.373	response to endogenous stimulus
GO:1902531	0.360	regulation of intracellular signal transduction
GO:0051239	0.359	regulation of multicellular organismal process
GO:0051240	0.351	positive regulation of multicellular organismal process
GO:0010468	0.335	regulation of gene expression
GO:1902533	0.327	positive regulation of intracellular signal transduction
GO:0006950	0.316	response to stress
GO:0048523	0.310	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0043226	0.995	organelle
GO:0012505	0.991	endomembrane system
GO:0005737	0.990	cytoplasm
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0031982	0.972	vesicle
GO:0070013	0.969	intracellular organelle lumen
GO:0031410	0.948	cytoplasmic vesicle
GO:0071944	0.916	cell periphery
GO:0005768	0.853	endosome
GO:0016020	0.728	membrane
GO:0005615	0.673	extracellular space
GO:0031904	0.442	endosome lumen
GO:0031981	0.427	nuclear lumen
GO:0005783	0.318	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]