StarFunc result for job id P0DML3

User Input

>input (217 residues)
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DML2	0.938	0.938	6.215E-27	217	0.995	0.995	P0DML2.pdb.gz	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
2	AFDB:P01241	0.927	0.927	3.093E-23	217	0.853	0.853	P01241.pdb.gz	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
3	PDB:1z7cA	0.686	0.913	1.917E-16	161	0.733	0.988	1z7cA.pdb.gz
4	AFDB:P01244	0.793	0.796	2.239E-16	216	0.604	0.606	P01244.pdb.gz	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
5	AFDB:A0FJ27	0.778	0.778	8.418E-16	217	0.608	0.608	A0FJ27.pdb.gz	A0FJ27_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
6	PDB:1bp3A	0.710	0.817	1.713E-14	186	0.724	0.844	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
7	AFDB:H6ULW9	0.783	0.787	4.688E-14	216	0.479	0.481	H6ULW9.pdb.gz	H6ULW9_CHICK Growth hormone OS=Gallus gallus OX=9031 GN=GH PE=3 SV=1
8	PDB:1huwA	0.641	0.821	3.760E-12	166	0.590	0.771	1huwA.pdb.gz
9	AFDB:Q1JQ34	0.701	0.722	2.903E-8	210	0.336	0.348	Q1JQ34.pdb.gz	Q1JQ34_DANRE Growth hormone 1 OS=Danio rerio OX=7955 GN=ghl PE=2 SV=1
10	AFDB:B2Z9Z2	0.673	0.693	1.041E-7	210	0.318	0.329	B2Z9Z2.pdb.gz	B2Z9Z2_SALSA Growth hormone 2 OS=Salmo salar OX=8030 GN=LOC106607462 PE=3 SV=1
11	AFDB:P01238	0.687	0.655	1.257E-7	229	0.276	0.262	P01238.pdb.gz	PRL_PIG Prolactin OS=Sus scrofa OX=9823 GN=PRL PE=1 SV=3
12	AFDB:A7LFX3	0.665	0.716	2.946E-7	200	0.318	0.345	A7LFX3.pdb.gz	A7LFX3_ICTPU Growth hormone OS=Ictalurus punctatus OX=7998 GN=gh1 PE=2 SV=1
13	AFDB:W5PH94	0.674	0.637	3.731E-7	231	0.272	0.255	W5PH94.pdb.gz	W5PH94_SHEEP Prolactin OS=Ovis aries OX=9940 GN=PRL PE=3 SV=1
14	PDB:1f6fA	0.647	0.756	3.736E-6	183	0.207	0.246	1f6fA.pdb.gz
15	PDB:3d48P	0.609	0.780	3.616E-5	165	0.198	0.261	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
16	PDB:1rw5A	0.630	0.678	5.279E-5	199	0.203	0.221	1rw5A.pdb.gz
17	PDB:6o4oA	0.491	0.604	5.262E-2	169	0.120	0.154	6o4oA.pdb.gz
18	PDB:7u7nD	0.577	0.647	1.233E-1	191	0.124	0.141	7u7nD.pdb.gz
19	PDB:3pivB	0.377	0.479	1.420E-1	157	0.092	0.127	3pivB.pdb.gz
20	PDB:4cniC	0.421	0.503	1.637E-1	171	0.129	0.164	4cniC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DML3	4.56e-164	452	217	1.000	1.000	CSH2_HUMAN Chorionic somatomammotropin hormone 2 OS=Homo sapiens OX=9606 GN=CSH2 PE=1 SV=1
2	P0DML2	6.63e-163	449	217	0.995	0.995	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
3	P01241	2.09e-121	345	217	0.853	0.853	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
4	P01242	7.07e-110	315	217	0.802	0.802	SOM2_HUMAN Growth hormone variant OS=Homo sapiens OX=9606 GN=GH2 PE=1 SV=3
5	P01248	2.63e-87	258	216	0.631	0.634	SOMA_PIG Somatotropin OS=Sus scrofa OX=9823 GN=GH1 PE=1 SV=2
6	P06880	8.77e-84	249	216	0.604	0.606	SOMA_MOUSE Somatotropin OS=Mus musculus OX=10090 GN=Gh1 PE=2 SV=1
7	P01244	2.89e-83	248	216	0.604	0.606	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
8	G3CI04	7.00e-83	247	217	0.618	0.618	G3CI04_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
9	Q0QBC4	2.09e-79	238	217	0.604	0.604	Q0QBC4_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
10	B0FPG6	3.11e-76	230	217	0.631	0.631	B0FPG6_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH PE=2 SV=1
11	P01246	3.11e-76	230	217	0.631	0.631	SOMA_BOVIN Somatotropin OS=Bos taurus OX=9913 GN=GH1 PE=1 SV=1
12	B0FPG4	7.05e-76	229	217	0.627	0.627	B0FPG4_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH1 PE=3 SV=1
13	Q95205	5.04e-75	227	204	0.571	0.608	Q95205_SHEEP Placental growth hormone (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
14	Q0QBC6	5.68e-75	227	217	0.622	0.622	Q0QBC6_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
15	A4GX95	8.98e-75	226	217	0.622	0.622	A4GX95_BOVIN Growth hormone OS=Bos taurus OX=9913 PE=2 SV=1
16	P67930	8.98e-75	226	217	0.622	0.622	SOMA_SHEEP Somatotropin OS=Ovis aries OX=9940 GN=GH1 PE=1 SV=1
17	Q71VP3	8.98e-75	226	217	0.622	0.622	Q71VP3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=2 SV=1
18	Q0QBF7	1.35e-74	226	217	0.622	0.622	Q0QBF7_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
19	Q0QBG3	1.75e-74	226	217	0.622	0.622	Q0QBG3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
20	Q0QBG8	2.37e-74	226	217	0.618	0.618	Q0QBG8_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00103 Hormone_1	3.6e-59	211.7	Somatotropin hormone family
2	PF19307 PCLP	4.8e+02	11.1	Phage capsid-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316416	0.996	Chorionic somatomammotropin hormone 1
2	9606.ENSP00000482954	0.975	Prolactin receptor
3	9606.ENSP00000483403	0.914	Growth hormone receptor
4	9606.ENSP00000302150	0.907	Prolactin
5	9606.ENSP00000312652	0.892	Leptin
6	9606.ENSP00000300175	0.868	Neuroendocrine protein 7B2
7	9606.ENSP00000312673	0.852	Somatotropin
8	9606.ENSP00000252723	0.836	Erythropoietin
9	9606.ENSP00000333157	0.822	Growth hormone 1 isoform 5
10	9606.ENSP00000225474	0.805	Granulocyte colony-stimulating factor
11	9606.ENSP00000215909	0.804	Galectin-1
12	9606.ENSP00000204615	0.800	Thrombopoietin
13	9606.ENSP00000355370	0.800	Ciliary neurotrophic factor
14	9606.ENSP00000380432	0.781	Insulin
15	9606.ENSP00000345772	0.768	Transcriptional enhancer factor TEF-5
16	9606.ENSP00000482232	0.760	Glycoprotein hormones, alpha polypeptide
17	9606.ENSP00000261799	0.743	Platelet-derived growth factor receptor beta
18	9606.ENSP00000371067	0.742	Tyrosine-protein kinase JAK2
19	9606.ENSP00000295225	0.726	Calsenilin
20	9606.ENSP00000472109	0.720	Transcriptional enhancer factor TEF-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.997	signaling receptor binding
GO:0005126	0.945	cytokine receptor binding
GO:0005131	0.926	growth hormone receptor binding
GO:0098772	0.902	molecular function regulator activity
GO:0030545	0.885	signaling receptor regulator activity
GO:0030546	0.884	signaling receptor activator activity
GO:0048018	0.873	receptor ligand activity
GO:0003824	0.365	catalytic activity
GO:0008083	0.340	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0019222	0.986	regulation of metabolic process
GO:0009893	0.976	positive regulation of metabolic process
GO:0031323	0.960	regulation of cellular metabolic process
GO:0009987	0.945	cellular process
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0031325	0.915	positive regulation of cellular metabolic process
GO:0042327	0.890	positive regulation of phosphorylation
GO:0051716	0.889	cellular response to stimulus
GO:0007154	0.882	cell communication
GO:0023052	0.881	signaling
GO:0080090	0.862	regulation of primary metabolic process
GO:0065009	0.856	regulation of molecular function
GO:0007165	0.851	signal transduction
GO:0044093	0.846	positive regulation of molecular function
GO:0010604	0.834	positive regulation of macromolecule metabolic process
GO:0051171	0.831	regulation of nitrogen compound metabolic process
GO:0051050	0.828	positive regulation of transport
GO:0001934	0.823	positive regulation of protein phosphorylation
GO:0050730	0.806	regulation of peptidyl-tyrosine phosphorylation
GO:0034762	0.795	regulation of transmembrane transport
GO:0007166	0.780	cell surface receptor signaling pathway
GO:0023051	0.763	regulation of signaling
GO:0010646	0.738	regulation of cell communication
GO:0034764	0.736	positive regulation of transmembrane transport
GO:0048583	0.733	regulation of response to stimulus
GO:0023056	0.708	positive regulation of signaling
GO:0010647	0.708	positive regulation of cell communication
GO:0009966	0.707	regulation of signal transduction
GO:0009967	0.686	positive regulation of signal transduction
GO:0050731	0.675	positive regulation of peptidyl-tyrosine phosphorylation
GO:0042221	0.637	response to chemical
GO:0010033	0.618	response to organic substance
GO:0032501	0.557	multicellular organismal process
GO:0009719	0.517	response to endogenous stimulus
GO:0070887	0.502	cellular response to chemical stimulus
GO:0009628	0.492	response to abiotic stimulus
GO:1902531	0.484	regulation of intracellular signal transduction
GO:0071310	0.483	cellular response to organic substance
GO:0042127	0.475	regulation of cell population proliferation
GO:0051239	0.462	regulation of multicellular organismal process
GO:0032502	0.440	developmental process
GO:1902533	0.437	positive regulation of intracellular signal transduction
GO:0048856	0.434	anatomical structure development
GO:0048519	0.433	negative regulation of biological process
GO:0006950	0.429	response to stress
GO:0007169	0.404	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0071495	0.375	cellular response to endogenous stimulus
GO:0048523	0.373	negative regulation of cellular process
GO:0010468	0.368	regulation of gene expression
GO:0051240	0.332	positive regulation of multicellular organismal process
GO:0008284	0.322	positive regulation of cell population proliferation
GO:1901700	0.308	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0043227	0.995	membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0043229	0.995	intracellular organelle
GO:0012505	0.991	endomembrane system
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0031982	0.973	vesicle
GO:0070013	0.971	intracellular organelle lumen
GO:0031410	0.952	cytoplasmic vesicle
GO:0071944	0.931	cell periphery
GO:0005768	0.911	endosome
GO:0005615	0.851	extracellular space
GO:0016020	0.740	membrane
GO:0031904	0.542	endosome lumen
GO:0005886	0.494	plasma membrane
GO:0005783	0.316	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]