StarFunc result for job id P0DMM9

User Input

>input (295 residues)
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDM
IYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLD
QKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNY
TTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DMM9	1.000	1.000	1.559E-59	295	1.000	1.000	P0DMM9.pdb.gz	ST1A3_HUMAN Sulfotransferase 1A3 OS=Homo sapiens OX=9606 GN=SULT1A3 PE=1 SV=1
2	PDB:3u3kA	0.976	0.996	9.436E-52	289	0.908	0.927	3u3kA.pdb.gz	The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
3	AFDB:P17988	0.974	0.988	2.614E-50	291	0.749	0.759	P17988.pdb.gz	ST1A1_RAT Sulfotransferase 1A1 OS=Rattus norvegicus OX=10116 GN=Sult1a1 PE=1 SV=1
4	AFDB:P52840	0.979	0.992	7.854E-48	291	0.705	0.715	P52840.pdb.gz	ST1A1_MOUSE Sulfotransferase 1A1 OS=Mus musculus OX=10090 GN=Sult1a1 PE=1 SV=1
5	AFDB:Q8JG30	0.977	0.973	4.712E-44	296	0.539	0.537	Q8JG30.pdb.gz	ST1B1_CHICK Sulfotransferase 1B1 OS=Gallus gallus OX=9031 GN=SULT1B1 PE=1 SV=1
6	AFDB:Q3UZZ6	0.976	0.976	1.633E-43	295	0.576	0.576	Q3UZZ6.pdb.gz	ST1D1_MOUSE Sulfotransferase 1 family member D1 OS=Mus musculus OX=10090 GN=Sult1d1 PE=1 SV=1
7	AFDB:Q95JD5	0.974	0.970	6.420E-42	296	0.532	0.530	Q95JD5.pdb.gz	ST1B1_CANLF Sulfotransferase 1B1 OS=Canis lupus familiaris OX=9615 GN=SULT1B1 PE=1 SV=1
8	AFDB:Q9QWG7	0.976	0.963	6.793E-42	299	0.525	0.518	Q9QWG7.pdb.gz	ST1B1_MOUSE Sulfotransferase 1B1 OS=Mus musculus OX=10090 GN=Sult1b1 PE=1 SV=2
9	AFDB:P52847	0.976	0.963	7.188E-42	299	0.529	0.522	P52847.pdb.gz	ST1B1_RAT Sulfotransferase 1B1 OS=Rattus norvegicus OX=10116 GN=Sult1b1 PE=1 SV=2
10	AFDB:Q3T0Y3	0.969	0.965	8.048E-42	296	0.515	0.514	Q3T0Y3.pdb.gz	ST1B1_BOVIN Sulfotransferase 1B1 OS=Bos taurus OX=9913 GN=SULT1B1 PE=1 SV=1
11	AFDB:O43704	0.973	0.970	2.636E-41	296	0.525	0.524	O43704.pdb.gz	ST1B1_HUMAN Sulfotransferase 1B1 OS=Homo sapiens OX=9606 GN=SULT1B1 PE=1 SV=2
12	PDB:3cklB	0.973	0.970	8.251E-41	296	0.525	0.524	3cklB.pdb.gz	Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol.
13	PDB:2zytX	0.966	0.979	1.094E-40	291	0.573	0.581	2zytX.pdb.gz	Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
14	PDB:4jvlA	0.946	0.956	9.214E-37	292	0.481	0.486	4jvlA.pdb.gz	Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
15	PDB:2gwhB	0.927	0.950	5.617E-36	288	0.529	0.542	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
16	PDB:1aqyA	0.907	0.945	1.973E-34	283	0.454	0.473	1aqyA.pdb.gz	Crystal structure of estrogen sulphotransferase.
17	PDB:1cjmA	0.735	0.967	6.836E-34	223	0.753	0.996	1cjmA.pdb.gz
18	PDB:3bfxA	0.827	0.960	3.228E-31	253	0.444	0.518	3bfxA.pdb.gz	Crystal Structures of Human Sulfotransferases Sult1B1 and Sult1C1 Complexed with the Cofactor Product Adenosine-3'-5'-Diphosphate (Pap).
19	PDB:2h8kA	0.769	0.921	5.513E-29	245	0.471	0.567	2h8kA.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
20	PDB:1q1qA	0.873	0.925	3.556E-28	278	0.359	0.381	1q1qA.pdb.gz	Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DMM9	0.0	616	295	1.000	1.000	ST1A3_HUMAN Sulfotransferase 1A3 OS=Homo sapiens OX=9606 GN=SULT1A3 PE=1 SV=1
2	P0DMN0	0.0	616	295	1.000	1.000	ST1A4_HUMAN Sulfotransferase 1A4 OS=Homo sapiens OX=9606 GN=SULT1A4 PE=1 SV=1
3	P50225	0.0	577	295	0.929	0.929	ST1A1_HUMAN Sulfotransferase 1A1 OS=Homo sapiens OX=9606 GN=SULT1A1 PE=1 SV=3
4	P50226	0.0	561	295	0.902	0.902	ST1A2_HUMAN Sulfotransferase 1A2 OS=Homo sapiens OX=9606 GN=SULT1A2 PE=1 SV=2
5	P17988	5.33e-164	459	291	0.749	0.759	ST1A1_RAT Sulfotransferase 1A1 OS=Rattus norvegicus OX=10116 GN=Sult1a1 PE=1 SV=1
6	P52840	2.51e-155	437	291	0.705	0.715	ST1A1_MOUSE Sulfotransferase 1A1 OS=Mus musculus OX=10090 GN=Sult1a1 PE=1 SV=1
7	Q3UZZ6	1.06e-129	372	295	0.573	0.573	ST1D1_MOUSE Sulfotransferase 1 family member D1 OS=Mus musculus OX=10090 GN=Sult1d1 PE=1 SV=1
8	Q8JG30	8.78e-124	357	296	0.536	0.534	ST1B1_CHICK Sulfotransferase 1B1 OS=Gallus gallus OX=9031 GN=SULT1B1 PE=1 SV=1
9	Q95JD5	4.49e-122	353	296	0.532	0.530	ST1B1_CANLF Sulfotransferase 1B1 OS=Canis lupus familiaris OX=9615 GN=SULT1B1 PE=1 SV=1
10	Q3T0Y3	1.43e-119	346	296	0.519	0.517	ST1B1_BOVIN Sulfotransferase 1B1 OS=Bos taurus OX=9913 GN=SULT1B1 PE=1 SV=1
11	O75897	2.06e-119	346	302	0.536	0.523	ST1C4_HUMAN Sulfotransferase 1C4 OS=Homo sapiens OX=9606 GN=SULT1C4 PE=1 SV=2
12	O43704	1.94e-118	343	296	0.525	0.524	ST1B1_HUMAN Sulfotransferase 1B1 OS=Homo sapiens OX=9606 GN=SULT1B1 PE=1 SV=2
13	Q9QWG7	6.70e-118	342	299	0.525	0.518	ST1B1_MOUSE Sulfotransferase 1B1 OS=Mus musculus OX=10090 GN=Sult1b1 PE=1 SV=2
14	A0A2K5X3B6	1.60e-117	342	302	0.525	0.513	ST1C4_MACFA Sulfotransferase 1C4 OS=Macaca fascicularis OX=9541 GN=SULT1C4 PE=1 SV=3
15	Q9WUW8	4.43e-116	337	296	0.532	0.530	ST1C2_RAT Sulfotransferase 1C2 OS=Rattus norvegicus OX=10116 GN=Sult1c2 PE=1 SV=2
16	Q9D939	1.05e-115	337	296	0.532	0.530	ST1C2_MOUSE Sulfotransferase 1C2 OS=Mus musculus OX=10090 GN=Sult1c2 PE=1 SV=1
17	Q9WUW9	2.52e-114	333	296	0.525	0.524	S1C2A_RAT Sulfotransferase 1C2A OS=Rattus norvegicus OX=10116 GN=Sult1c2a PE=1 SV=2
18	O46503	4.92e-113	330	296	0.512	0.510	ST1C2_RABIT Sulfotransferase 1C2 OS=Oryctolagus cuniculus OX=9986 GN=SULT1C2 PE=1 SV=1
19	Q6IMI6	4.22e-112	328	304	0.529	0.513	ST1C3_HUMAN Sulfotransferase 1C3 OS=Homo sapiens OX=9606 GN=SULT1C3 PE=1 SV=1
20	Q80VR3	4.31e-112	328	304	0.515	0.500	ST1C1_MOUSE Sulfotransferase 1C1 OS=Mus musculus OX=10090 GN=Sult1c1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00685 Sulfotransfer_1	2.2e-81	284.8	Sulfotransferase domain
2	PF13469 Sulfotransfer_3	1.1e-06	40.8	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378972	0.947	Sulfotransferase 1A1
2	9606.ENSP00000353600	0.924	Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4
3	9606.ENSP00000216037	0.900	X-box-binding protein 1
4	9606.ENSP00000403644	0.900	Aromatic-L-amino-acid decarboxylase
5	9606.ENSP00000332565	0.887	Sulfotransferase 4A1
6	9606.ENSP00000378992	0.885	Sulfotransferase 1A2
7	9606.ENSP00000319622	0.879	Sulfotransferase 1C2
8	9606.ENSP00000366307	0.860	Thrombomodulin
9	9606.ENSP00000347739	0.801	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs
10	9606.ENSP00000359539	0.739	Aspartate aminotransferase, cytoplasmic
11	9606.ENSP00000222002	0.659	Bile salt sulfotransferase
12	9606.ENSP00000384950	0.653	Sulfotransferase 6B1
13	9606.ENSP00000226444	0.633	Estrogen sulfotransferase
14	9606.ENSP00000308770	0.630	Sulfotransferase family cytosolic 1B member 1
15	9606.ENSP00000261405	0.619	Von Willebrand factor
16	9606.ENSP00000217961	0.606	Steryl-sulfatase
17	9606.ENSP00000305702	0.579	BTB/POZ domain-containing protein KCTD19
18	9606.ENSP00000356671	0.566	Antithrombin-III
19	9606.ENSP00000216968	0.518	Endothelial protein C receptor
20	9606.ENSP00000223095	0.505	Plasminogen activator inhibitor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004062	0.998	aryl sulfotransferase activity
GO:0043167	0.995	ion binding
GO:0005515	0.991	protein binding
GO:1901681	0.853	sulfur compound binding
GO:0043168	0.772	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.989	cellular metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0050896	0.977	response to stimulus
GO:0051923	0.970	sulfation
GO:0071466	0.951	cellular response to xenobiotic stimulus
GO:0006807	0.933	nitrogen compound metabolic process
GO:1901360	0.923	organic cyclic compound metabolic process
GO:1901564	0.890	organonitrogen compound metabolic process
GO:0006805	0.888	xenobiotic metabolic process
GO:1901616	0.882	organic hydroxy compound catabolic process
GO:0006725	0.869	cellular aromatic compound metabolic process
GO:0033875	0.846	ribonucleoside bisphosphate metabolic process
GO:0034032	0.846	purine nucleoside bisphosphate metabolic process
GO:0009150	0.843	purine ribonucleotide metabolic process
GO:0065007	0.733	biological regulation
GO:0006066	0.598	alcohol metabolic process
GO:0044282	0.488	small molecule catabolic process
GO:0046164	0.437	alcohol catabolic process
GO:0034308	0.423	primary alcohol metabolic process
GO:0043436	0.412	oxoacid metabolic process
GO:0009308	0.326	amine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12164	0.998	3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+)
EC:2.8.2.1	0.998	aryl sulfotransferase.

[back to server]