StarFunc result for job id P0DMP2

User Input

>input (458 residues)
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTFLSAELN
LEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQP
VQSELLQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMES
VKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A208	0.965	0.418	2.794E-47	1071	0.978	0.418	D4A208.pdb.gz	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
2	AFDB:Q91Z69	0.937	0.409	2.001E-41	1062	0.775	0.334	Q91Z69.pdb.gz	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
3	AFDB:Q7Z6B7	0.941	0.400	2.298E-41	1085	0.782	0.330	Q7Z6B7.pdb.gz	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
4	AFDB:O43295	0.948	0.399	9.959E-38	1099	0.683	0.285	O43295.pdb.gz	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
5	AFDB:P98171	0.877	0.435	9.293E-26	946	0.441	0.214	P98171.pdb.gz	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
6	AFDB:A0A0G2JVF0	0.896	0.440	4.870E-25	955	0.432	0.207	A0A0G2JVF0.pdb.gz	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
7	AFDB:E7EQN5	0.763	0.386	3.357E-23	925	0.417	0.206	E7EQN5.pdb.gz	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
8	AFDB:Q19370	0.772	0.346	1.739E-16	1059	0.260	0.112	Q19370.pdb.gz	Q19370_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=srgp-1 PE=1 SV=2
9	AFDB:O94868	0.566	0.369	4.740E-11	740	0.199	0.123	O94868.pdb.gz	FCSD2_HUMAN F-BAR and double SH3 domains protein 2 OS=Homo sapiens OX=9606 GN=FCHSD2 PE=1 SV=3
10	AFDB:Q55CK2	0.378	0.218	1.881E-9	877	0.164	0.086	Q55CK2.pdb.gz	MGP2_DICDI GTPase activating protein homolog 2 OS=Dictyostelium discoideum OX=44689 GN=mgp2 PE=3 SV=1
11	PDB:3hajA	0.281	0.405	4.981E-6	286	0.105	0.168	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
12	PDB:6ikoA	0.329	0.458	2.167E-4	303	0.085	0.129	6ikoA.pdb.gz
13	PDB:7rroA3	0.152	0.204	1.877E-1	334	0.109	0.150	7rroA3.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:7p5cA	0.113	0.128	1.965E-1	392	0.072	0.084	7p5cA.pdb.gz
15	PDB:7ungA3	0.153	0.205	1.965E-1	333	0.103	0.141	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7p5jA	0.138	0.153	2.058E-1	399	0.076	0.088	7p5jA.pdb.gz
17	PDB:6xz6A	0.152	0.273	2.974E-1	213	0.059	0.127	6xz6A.pdb.gz
18	PDB:7vgfA	0.131	0.115	3.414E-1	550	0.096	0.080	7vgfA.pdb.gz	Cryo-EM structure of AMP-PNP-bound human mitochondrial ATP-binding cassette transporter ABCB7.
19	PDB:5mkkA	0.162	0.132	3.743E-1	593	0.094	0.073	5mkkA.pdb.gz
20	PDB:4q4aA	0.110	0.091	4.499E-1	572	0.090	0.072	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YEY3	0.0	942	459	1.000	0.998	A0A286YEY3_HUMAN SLIT-ROBO Rho GTPase activating protein 2B OS=Homo sapiens OX=9606 GN=SRGAP2B PE=1 SV=1
2	B7ZM87	0.0	924	1070	0.980	0.420	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
3	D4A208	0.0	914	1071	0.976	0.417	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
4	O43295	0.0	644	1099	0.690	0.288	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
5	O75044	0.0	919	1071	0.980	0.419	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
6	P0DJJ0	0.0	921	459	0.985	0.983	SRG2C_HUMAN SLIT-ROBO Rho GTPase-activating protein 2C OS=Homo sapiens OX=9606 GN=SRGAP2C PE=1 SV=1
7	Q7Z6B7	0.0	731	1085	0.779	0.329	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
8	Q812A2	0.0	641	1099	0.683	0.285	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
9	Q91Z67	0.0	919	1071	0.978	0.418	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2
10	Q91Z69	0.0	729	1062	0.777	0.335	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
11	Q8IXS7	6.44e-164	467	335	0.504	0.690	Q8IXS7_HUMAN SRGAP3 protein OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=1
12	P98171	6.04e-141	429	946	0.452	0.219	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
13	E7EQN5	9.14e-130	399	925	0.432	0.214	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
14	A0A0G2JVF0	5.03e-122	380	965	0.434	0.206	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
15	Q8K4G7	5.89e-122	380	965	0.434	0.206	Q8K4G7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=2 SV=1
16	A0A8I6AIK5	7.77e-114	358	934	0.413	0.202	A0A8I6AIK5_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
17	A0A8I5ZY52	7.42e-113	355	921	0.410	0.204	A0A8I5ZY52_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
18	A0A8I6AN89	5.02e-69	237	881	0.271	0.141	A0A8I6AN89_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
19	Q19370	1.30e-52	192	1059	0.266	0.115	Q19370_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=srgp-1 PE=1 SV=2
20	D3YT53	1.96e-48	180	998	0.253	0.116	D3YT53_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=srgp-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	1.1e-17	75.4	Fes/CIP4, and EFC/F-BAR homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477776

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481934	0.553	Rho GTPase-activating protein 11B
2	9606.ENSP00000315731	0.539	Meteorin-like protein
3	9606.ENSP00000360076	0.515	SH3-containing GRB2-like protein 3-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0008289	0.527	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007399	0.991	nervous system development
GO:0050794	0.990	regulation of cellular process
GO:0048869	0.987	cellular developmental process
GO:0030154	0.982	cell differentiation
GO:0021543	0.937	pallium development
GO:0021987	0.933	cerebral cortex development
GO:0040012	0.912	regulation of locomotion
GO:0071840	0.906	cellular component organization or biogenesis
GO:0060491	0.850	regulation of cell projection assembly
GO:0021799	0.845	cerebral cortex radially oriented cell migration
GO:0008347	0.830	glial cell migration
GO:0048518	0.826	positive regulation of biological process
GO:2000145	0.826	regulation of cell motility
GO:0120032	0.823	regulation of plasma membrane bounded cell projection assembly
GO:0048522	0.811	positive regulation of cellular process
GO:0030334	0.808	regulation of cell migration
GO:0016043	0.776	cellular component organization
GO:2001222	0.732	regulation of neuron migration
GO:0034330	0.705	cell junction organization
GO:0048519	0.664	negative regulation of biological process
GO:0051489	0.662	regulation of filopodium assembly
GO:2001224	0.654	positive regulation of neuron migration
GO:0060998	0.606	regulation of dendritic spine development
GO:0048523	0.580	negative regulation of cellular process
GO:0034329	0.426	cell junction assembly
GO:0031345	0.346	negative regulation of cell projection organization
GO:0030030	0.344	cell projection organization
GO:0120036	0.334	plasma membrane bounded cell projection organization
GO:0007416	0.315	synapse assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0043228	0.916	non-membrane-bounded organelle
GO:0016020	0.915	membrane
GO:0043232	0.857	intracellular non-membrane-bounded organelle
GO:0005829	0.820	cytosol
GO:0005886	0.455	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]