StarFunc result for job id P0DMS9

User Input

>input (266 residues)
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW
LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF
SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA
NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR
NRRVGNTLKPFSRVLTPKEMAPTEQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DMS9	1.000	1.000	4.340E-51	266	1.000	1.000	P0DMS9.pdb.gz	TMIG3_HUMAN Transmembrane domain-containing protein TMIGD3 OS=Homo sapiens OX=9606 GN=TMIGD3 PE=1 SV=1
2	AFDB:Q08708	0.358	0.419	4.318E-12	224	0.199	0.237	Q08708.pdb.gz	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
3	AFDB:Q8VCH2	0.355	0.424	6.302E-12	221	0.162	0.195	Q8VCH2.pdb.gz	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
4	AFDB:Q7TSN2	0.367	0.422	9.796E-12	228	0.165	0.193	Q7TSN2.pdb.gz	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
5	AFDB:Q9UGN4	0.358	0.321	1.043E-11	299	0.169	0.151	Q9UGN4.pdb.gz	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
6	AFDB:Q86YW5	0.363	0.315	1.111E-11	311	0.180	0.154	Q86YW5.pdb.gz	TRML1_HUMAN Trem-like transcript 1 protein OS=Homo sapiens OX=9606 GN=TREML1 PE=1 SV=2
7	AFDB:Q8TDQ1	0.348	0.320	1.959E-11	290	0.132	0.121	Q8TDQ1.pdb.gz	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
8	AFDB:Q6SJQ5	0.358	0.387	2.685E-11	245	0.158	0.171	Q6SJQ5.pdb.gz	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
9	AFDB:Q6UXZ3	0.357	0.482	3.454E-11	194	0.120	0.165	Q6UXZ3.pdb.gz	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
10	AFDB:Q8BNV8	0.357	0.409	4.173E-11	229	0.173	0.201	Q8BNV8.pdb.gz	Q8BNV8_MOUSE Plasmacytoid dendritic cell-specific receptor OS=Mus musculus OX=10090 GN=A530064D06Rik PE=1 SV=1
11	PDB:6xdsA	0.325	0.183	4.010E-7	485	0.083	0.045	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
12	PDB:6dldD	0.294	0.291	4.548E-7	269	0.056	0.056	6dldD.pdb.gz
13	PDB:6dlfA	0.282	0.316	1.099E-6	236	0.071	0.081	6dlfA.pdb.gz
14	PDB:6vpyL	0.301	0.377	4.396E-6	209	0.056	0.072	6vpyL.pdb.gz
15	PDB:1cd0A	0.296	0.661	5.311E-6	111	0.068	0.162	1cd0A.pdb.gz
16	PDB:6jxrm	0.291	0.310	5.656E-6	248	0.056	0.060	6jxrm.pdb.gz
17	PDB:5ir3A	0.309	0.685	7.278E-6	111	0.056	0.135	5ir3A.pdb.gz
18	PDB:2cd0A	0.294	0.657	7.751E-6	111	0.064	0.153	2cd0A.pdb.gz
19	PDB:2qhrL	0.279	0.333	8.255E-6	218	0.053	0.064	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
20	PDB:4aizA	0.283	0.649	8.255E-6	107	0.060	0.150	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DMS9	0.0	555	266	1.000	1.000	TMIG3_HUMAN Transmembrane domain-containing protein TMIGD3 OS=Homo sapiens OX=9606 GN=TMIGD3 PE=1 SV=1
2	Q8VCH2	8.99e-09	56.6	221	0.128	0.154	CLM5_MOUSE CMRF35-like molecule 5 OS=Mus musculus OX=10090 GN=Cd300ld PE=1 SV=1
3	Q1ERP8	1.66e-08	56.6	331	0.135	0.109	CLM9_MOUSE CMRF35-like molecule 9 OS=Mus musculus OX=10090 GN=Cd300lg PE=1 SV=1
4	Q496F6	5.14e-08	54.3	205	0.120	0.156	CLM2_HUMAN CMRF35-like molecule 2 OS=Homo sapiens OX=9606 GN=CD300E PE=1 SV=2
5	Q6UXG3	1.11e-07	54.3	332	0.117	0.093	CLM9_HUMAN CMRF35-like molecule 9 OS=Homo sapiens OX=9606 GN=CD300LG PE=1 SV=2
6	Q6SJQ5	3.14e-07	52.4	245	0.102	0.110	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1
7	Q6SJQ7	2.50e-06	50.1	337	0.098	0.077	CLM1_MOUSE CMRF35-like molecule 1 OS=Mus musculus OX=10090 GN=Cd300lf PE=1 SV=1
8	Q9UGN4	4.38e-06	49.3	299	0.109	0.097	CLM8_HUMAN CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A PE=1 SV=2
9	A8K4G0	4.99e-06	48.5	201	0.090	0.119	CLM7_HUMAN CMRF35-like molecule 7 OS=Homo sapiens OX=9606 GN=CD300LB PE=1 SV=2
10	Q3U497	5.29e-06	48.5	209	0.120	0.153	CLM7_MOUSE CMRF35-like molecule 7 OS=Mus musculus OX=10090 GN=Cd300lb PE=1 SV=2
11	Q08708	5.84e-06	48.5	224	0.154	0.183	CLM6_HUMAN CMRF35-like molecule 6 OS=Homo sapiens OX=9606 GN=CD300C PE=1 SV=1
12	P15083	2.73e-05	47.4	769	0.083	0.029	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
13	Q7TSN2	3.55e-05	46.2	228	0.120	0.140	CLM4_MOUSE CMRF-35-like molecule 4 OS=Mus musculus OX=10090 GN=Cd300c2 PE=1 SV=2
14	Q6UXZ3	7.86e-05	44.7	194	0.090	0.124	CLM5_HUMAN CMRF35-like molecule 5 OS=Homo sapiens OX=9606 GN=CD300LD PE=1 SV=1
15	Q8TDQ1	1.27e-04	44.7	290	0.109	0.100	CLM1_HUMAN CMRF35-like molecule 1 OS=Homo sapiens OX=9606 GN=CD300LF PE=1 SV=3
16	P01832	0.001	42.7	773	0.083	0.028	PIGR_RABIT Polymeric immunoglobulin receptor OS=Oryctolagus cuniculus OX=9986 GN=PIGR PE=1 SV=1
17	Q6SJQ0	0.002	41.6	318	0.094	0.079	CLM8_MOUSE CMRF35-like molecule 8 OS=Mus musculus OX=10090 GN=Cd300a PE=1 SV=2
18	P01833	0.005	40.4	764	0.079	0.027	PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4
19	Q8WWV6	0.023	38.5	532	0.117	0.058	FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor OS=Homo sapiens OX=9606 GN=FCAMR PE=1 SV=1
20	Q86YW5	0.031	37.7	311	0.150	0.129	TRML1_HUMAN Trem-like transcript 1 protein OS=Homo sapiens OX=9606 GN=TREML1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07686 V-set	5.9	18.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361965	0.909	Adenosine deaminase
2	9606.ENSP00000257770	0.787	5'-nucleotidase
3	9606.ENSP00000360250	0.770	Ectonucleoside triphosphate diphosphohydrolase 1
4	9606.ENSP00000286621	0.768	Adenosine kinase
5	9606.ENSP00000078429	0.758	Guanine nucleotide-binding protein subunit alpha-11
6	9606.ENSP00000403701	0.751	Beta-arrestin-2
7	9606.ENSP00000382731	0.740	Adenosine deaminase 2
8	9606.ENSP00000320376	0.707	P2Y purinoceptor 13
9	9606.ENSP00000377424	0.687	Equilibrative nucleoside transporter 1
10	9606.ENSP00000310305	0.686	P2Y purinoceptor 2
11	9606.ENSP00000307259	0.683	P2Y purinoceptor 12
12	9606.ENSP00000225538	0.675	P2X purinoceptor 1
13	9606.ENSP00000304767	0.642	P2Y purinoceptor 1
14	9606.ENSP00000261007	0.641	Acetylcholine receptor subunit alpha
15	9606.ENSP00000480966	0.630	P2Y purinoceptor 6
16	9606.ENSP00000308361	0.625	P2Y purinoceptor 14
17	9606.ENSP00000350024	0.614	Equilibrative nucleoside transporter 2
18	9606.ENSP00000353032	0.614	P2X purinoceptor 4
19	9606.ENSP00000347213	0.611	Ectonucleoside triphosphate diphosphohydrolase 2
20	9606.ENSP00000363643	0.611	P2Y purinoceptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043085	0.995	positive regulation of catalytic activity
GO:0009987	0.991	cellular process
GO:0006950	0.983	response to stress
GO:0050794	0.982	regulation of cellular process
GO:0051349	0.975	positive regulation of lyase activity
GO:0031281	0.975	positive regulation of cyclase activity
GO:0040012	0.969	regulation of locomotion
GO:0051716	0.966	cellular response to stimulus
GO:0044092	0.963	negative regulation of molecular function
GO:0051090	0.963	regulation of DNA-binding transcription factor activity
GO:0051239	0.961	regulation of multicellular organismal process
GO:0007165	0.948	signal transduction
GO:0045761	0.946	regulation of adenylate cyclase activity
GO:0045762	0.934	positive regulation of adenylate cyclase activity
GO:0048519	0.782	negative regulation of biological process
GO:2000145	0.642	regulation of cell motility
GO:0042127	0.619	regulation of cell population proliferation
GO:0040013	0.523	negative regulation of locomotion
GO:0006952	0.486	defense response
GO:0048523	0.484	negative regulation of cellular process
GO:0030334	0.467	regulation of cell migration
GO:0032088	0.435	negative regulation of NF-kappaB transcription factor activity
GO:0044057	0.364	regulation of system process
GO:0008285	0.358	negative regulation of cell population proliferation
GO:0030336	0.357	negative regulation of cell migration
GO:1903522	0.341	regulation of blood circulation
GO:0008016	0.325	regulation of heart contraction
GO:0009611	0.323	response to wounding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]