StarFunc result for job id P0DMT0

User Input

>input (46 residues)
MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CV60	1.58e-21	79.3	46	0.804	0.804	MLN_MOUSE Myoregulin OS=Mus musculus OX=10090 GN=Mrln PE=1 SV=2
2	Q9Y2H6	6.1	25.8	1198	0.326	0.013	FND3A_HUMAN Fibronectin type-III domain-containing protein 3A OS=Homo sapiens OX=9606 GN=FNDC3A PE=1 SV=4
3	Q7JRE4	6.9	25.4	650	0.196	0.014	MAN1_DROME Inner nuclear membrane protein Man1 OS=Drosophila melanogaster OX=7227 GN=MAN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098772	0.999	molecular function regulator activity
GO:0005515	0.999	protein binding
GO:0140678	0.868	molecular function inhibitor activity
GO:0004857	0.665	enzyme inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043269	0.867	regulation of monoatomic ion transport
GO:0010959	0.859	regulation of metal ion transport
GO:0034762	0.858	regulation of transmembrane transport
GO:1904062	0.846	regulation of monoatomic cation transmembrane transport
GO:0051924	0.430	regulation of calcium ion transport
GO:0043271	0.418	negative regulation of monoatomic ion transport
GO:1901019	0.418	regulation of calcium ion transmembrane transporter activity
GO:0009987	0.393	cellular process
GO:0050896	0.364	response to stimulus
GO:0048523	0.326	negative regulation of cellular process
GO:0034766	0.320	negative regulation of monoatomic ion transmembrane transport
GO:0044092	0.309	negative regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0005783	0.983	endoplasmic reticulum
GO:0016020	0.980	membrane
GO:0031090	0.969	organelle membrane
GO:0016528	0.963	sarcoplasm
GO:0098588	0.947	bounding membrane of organelle
GO:0005789	0.946	endoplasmic reticulum membrane
GO:0033017	0.930	sarcoplasmic reticulum membrane
GO:0071944	0.331	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name