StarFunc result for job id P0DMW2

User Input

>input (45 residues)
MVSSAQLDFNLQALLGQLSQDDLCKFKSLIRTVSLGNELQKIPQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DMW2	1.000	1.000	3.718E-7	45	1.000	1.000	P0DMW2.pdb.gz	PYDC4_HUMAN NLR family pyrin domain-containing protein 2B OS=Homo sapiens OX=9606 GN=NLRP2B PE=2 SV=1
2	AFDB:P59045	0.572	0.032	1.986	1033	0.311	0.014	P59045.pdb.gz	NAL11_HUMAN NACHT, LRR and PYD domains-containing protein 11 OS=Homo sapiens OX=9606 GN=NLRP11 PE=2 SV=2
3	AFDB:O14170	0.283	0.040	2.150	703	0.267	0.017	O14170.pdb.gz	POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop2 PE=1 SV=1
4	AFDB:J3KN38	0.614	0.154	3.192	203	0.111	0.025	J3KN38.pdb.gz	J3KN38_HUMAN Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1
5	AFDB:Q8NE22	0.618	0.108	4.046	299	0.222	0.033	Q8NE22.pdb.gz	SETD9_HUMAN SET domain-containing protein 9 OS=Homo sapiens OX=9606 GN=SETD9 PE=2 SV=2
6	AFDB:O94280	0.648	0.082	4.738	374	0.133	0.016	O94280.pdb.gz	YGX1_SCHPO UPF0674 endoplasmic reticulum membrane protein C2G5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G5.01 PE=3 SV=1
7	AFDB:Q10B19	0.338	0.099	4.738	250	0.178	0.032	Q10B19.pdb.gz	TRM13_ORYSJ tRNA:m(4)X modification enzyme TRM13 OS=Oryza sativa subsp. japonica OX=39947 GN=TRM13 PE=1 SV=1
8	AFDB:Q3USZ2	0.652	0.086	4.738	394	0.133	0.015	Q3USZ2.pdb.gz	UBFL1_MOUSE Upstream-binding factor 1-like protein 1 OS=Mus musculus OX=10090 GN=Ubtfl1 PE=1 SV=1
9	AFDB:Q9YDF8	0.667	0.117	5.128	295	0.111	0.017	Q9YDF8.pdb.gz	KVAP_AERPE Voltage-gated potassium channel OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=APE_0955 PE=1 SV=1
10	AFDB:P12689	0.446	0.038	5.550	985	0.200	0.009	P12689.pdb.gz	REV1_YEAST DNA repair protein REV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REV1 PE=1 SV=2
11	PDB:7s4uA	0.397	0.028	6.426	1092	0.200	0.008	7s4uA.pdb.gz	Structural basis for mismatch surveillance by CRISPR-Cas9.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DMW2	5.95e-26	90.1	45	1.000	1.000	PYDC4_HUMAN NLR family pyrin domain-containing protein 2B OS=Homo sapiens OX=9606 GN=NLRP2B PE=2 SV=1
2	Q56P42	4.18e-19	74.3	97	0.800	0.371	PYDC2_HUMAN Pyrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PYDC2 PE=1 SV=1
3	J3KN39	1.53e-13	63.9	1059	0.733	0.031	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
4	Q9NX02	1.56e-13	63.9	1062	0.733	0.031	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
5	Q8WX94	7.76e-05	39.3	980	0.444	0.020	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
6	Q96MN2	0.12	30.4	994	0.356	0.016	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
7	Q7RTR0	3.9	26.2	991	0.333	0.015	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
8	P12111	8.5	25.4	3177	0.356	0.005	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02758 PYRIN	2.4	19.7	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000016189

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000008260	0.847	PYD and CARD domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.579	catalytic activity
GO:0042802	0.452	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051246	0.969	regulation of protein metabolic process
GO:0060759	0.966	regulation of response to cytokine stimulus
GO:0048519	0.965	negative regulation of biological process
GO:0001959	0.964	regulation of cytokine-mediated signaling pathway
GO:0010648	0.961	negative regulation of cell communication
GO:0065009	0.960	regulation of molecular function
GO:0048585	0.959	negative regulation of response to stimulus
GO:0031347	0.951	regulation of defense response
GO:0032101	0.940	regulation of response to external stimulus
GO:0010803	0.935	regulation of tumor necrosis factor-mediated signaling pathway
GO:0044092	0.931	negative regulation of molecular function
GO:0009968	0.931	negative regulation of signal transduction
GO:0010468	0.914	regulation of gene expression
GO:0001932	0.904	regulation of protein phosphorylation
GO:0060761	0.902	negative regulation of response to cytokine stimulus
GO:0043433	0.869	negative regulation of DNA-binding transcription factor activity
GO:0032088	0.864	negative regulation of NF-kappaB transcription factor activity
GO:0002682	0.860	regulation of immune system process
GO:0010605	0.860	negative regulation of macromolecule metabolic process
GO:0001960	0.824	negative regulation of cytokine-mediated signaling pathway
GO:0045088	0.780	regulation of innate immune response
GO:0033135	0.715	regulation of peptidyl-serine phosphorylation
GO:0048518	0.701	positive regulation of biological process
GO:0051248	0.601	negative regulation of protein metabolic process
GO:0031324	0.501	negative regulation of cellular metabolic process
GO:0001933	0.489	negative regulation of protein phosphorylation
GO:0048522	0.390	positive regulation of cellular process
GO:0002683	0.317	negative regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.582	intracellular organelle lumen
GO:0031981	0.560	nuclear lumen
GO:0005654	0.373	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]