StarFunc result for job id P0DMW4

User Input

>input (78 residues)
MAASAALSAAAAAAALSGLAVRLSRSAAARGSYGAFCKGLTRTLLTFFDLAWRLRMNFPY
FYIVASVMLNVRLQVRIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	PDB:5gm6c	0.321	0.065	8.438	415	0.205	0.039	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
	2	PDB:5gmkc	0.321	0.062	8.438	436	0.205	0.037	5gmkc.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14739	7.4	26.9	615	0.192	0.024	LBR_HUMAN Delta(14)-sterol reductase LBR OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15118 DUF4560	1.4e-35	132.3	Domain of unknown function (DUF4560)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10090.ENSMUSP00000098428

Rank	PPI partner	STRING score	Description
1	10090.ENSMUSP00000098374	0.700	Transmembrane protein 254a
2	10090.ENSMUSP00000098369	0.680	Transmembrane protein 254b
3	10090.ENSMUSP00000056665	0.583	Belongs to the PLAC9 family
4	10090.ENSMUSP00000139134	0.583	Placenta-specific protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.998	catalytic activity
GO:0005515	0.998	protein binding
GO:0000386	0.527	second spliceosomal transesterification activity
GO:0000384	0.527	first spliceosomal transesterification activity
GO:0019904	0.330	protein domain specific binding
GO:0003723	0.324	RNA binding
GO:0003677	0.324	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.905	cellular process
GO:0050789	0.864	regulation of biological process
GO:0071840	0.836	cellular component organization or biogenesis
GO:0016043	0.801	cellular component organization
GO:0050794	0.784	regulation of cellular process
GO:0048519	0.690	negative regulation of biological process
GO:0048523	0.681	negative regulation of cellular process
GO:0006996	0.585	organelle organization
GO:0051726	0.329	regulation of cell cycle
GO:0042127	0.326	regulation of cell population proliferation
GO:0048522	0.326	positive regulation of cellular process
GO:0010468	0.326	regulation of gene expression
GO:0050793	0.325	regulation of developmental process
GO:0019219	0.325	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.709	nucleus
GO:0032991	0.434	protein-containing complex
GO:0016020	0.408	membrane
GO:0005739	0.393	mitochondrion
GO:0000974	0.390	Prp19 complex
GO:0071006	0.390	U2-type catalytic step 1 spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]