StarFunc result for job id P0DN84

User Input

>input (35 residues)
MAEKAGSTFSHLLVPILLLIGWIVGCIIMIYVVFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DN84	4.49e-18	69.7	35	1.000	1.000	DWORF_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF OS=Homo sapiens OX=9606 GN=STRIT1 PE=1 SV=2
2	P0DN83	2.19e-10	50.4	34	0.743	0.765	DWORF_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF OS=Mus musculus OX=10090 GN=Strit1 PE=1 SV=1
3	P70289	2.0	26.6	1705	0.257	0.005	PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus OX=10090 GN=Ptprv PE=1 SV=1
4	G5EB86	2.1	26.6	1905	0.343	0.006	G5EB86_EMENI 1,3-beta-glucan synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03729 PE=3 SV=1
5	G0YV93	7.6	24.6	904	0.343	0.013	G0YV93_9CAUD DNA polymerase OS=Pseudomonas phage PaP1 OX=685892 GN=PaP1_gp090 PE=4 SV=1
6	O93927	8.7	24.6	1799	0.343	0.007	FKS1_CRYNH 1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=FKS1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1443113.LC20_04886

Rank	PPI partner	STRING score	Description
1	1443113.LC20_04887	0.988	annotation not available
2	1443113.LC20_04888	0.982	annotation not available
3	1443113.LC20_04889	0.979	annotation not available
4	1443113.LC20_04894	0.942	annotation not available
5	1443113.LC20_04895	0.941	annotation not available
6	1443113.LC20_04893	0.940	annotation not available
7	1443113.LC20_04900	0.904	annotation not available
8	1443113.LC20_01531	0.895	annotation not available
9	1443113.LC20_01533	0.887	annotation not available
10	1443113.LC20_01538	0.875	annotation not available
11	1443113.LC20_02178	0.874	annotation not available
12	1443113.LC20_01540	0.835	annotation not available
13	1443113.LC20_02147	0.804	Required for formation of the rod structure of the flagellar apparatus. Together with FliI and FliH, may constitute the export apparatus of flagellin (By similarity)
14	1443113.LC20_04909	0.803	annotation not available
15	1443113.LC20_04910	0.803	annotation not available
16	1443113.LC20_01524	0.791	annotation not available
17	1443113.LC20_02172	0.773	FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation.
18	1443113.LC20_02170	0.771	Plays a role in the flagellum-specific transport system.
19	1443113.LC20_02169	0.752	Role in flagellar biosynthesis.
20	1443113.LC20_04890	0.748	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0055117	0.880	regulation of cardiac muscle contraction
GO:0050794	0.395	regulation of cellular process
GO:0065009	0.317	regulation of molecular function
GO:0034762	0.314	regulation of transmembrane transport
GO:0032409	0.313	regulation of transporter activity
GO:0051924	0.312	regulation of calcium ion transport
GO:1903115	0.301	regulation of actin filament-based movement
GO:0032412	0.301	regulation of monoatomic ion transmembrane transporter activity
GO:1903169	0.300	regulation of calcium ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005622	0.986	intracellular anatomical structure
GO:0005737	0.980	cytoplasm
GO:0043226	0.957	organelle
GO:0043229	0.886	intracellular organelle
GO:0031090	0.875	organelle membrane
GO:0031984	0.875	organelle subcompartment
GO:0005789	0.874	endoplasmic reticulum membrane
GO:0098588	0.873	bounding membrane of organelle
GO:0016529	0.858	sarcoplasmic reticulum
GO:0033017	0.850	sarcoplasmic reticulum membrane
GO:0071944	0.738	cell periphery
GO:0005886	0.710	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]