StarFunc result for job id P0DP58

User Input

>input (116 residues)
MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKV
SKSCVPRCFETVYDGYSKHASTTSCCQYDLCNGTGLATPATLALAPILLATLWGLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DP58	1.000	1.000	1.603E-21	116	1.000	1.000	P0DP58.pdb.gz	LYNX1_HUMAN Ly-6/neurotoxin-like protein 1 OS=Homo sapiens OX=9606 GN=LYNX1 PE=1 SV=1
2	AFDB:P0DP60	0.723	0.723	1.517E-15	116	0.810	0.810	P0DP60.pdb.gz	LYNX1_MOUSE Ly-6/neurotoxin-like protein 1 OS=Mus musculus OX=10090 GN=Lynx1 PE=1 SV=1
3	AFDB:P35459	0.600	0.557	5.782E-9	127	0.362	0.331	P35459.pdb.gz	LY6D_MOUSE Lymphocyte antigen 6D OS=Mus musculus OX=10090 GN=Ly6d PE=1 SV=1
4	AFDB:Q14210	0.600	0.553	3.114E-8	128	0.328	0.297	Q14210.pdb.gz	LY6D_HUMAN Lymphocyte antigen 6D OS=Homo sapiens OX=9606 GN=LY6D PE=1 SV=1
5	AFDB:Q9CWP4	0.555	0.425	6.250E-8	154	0.345	0.260	Q9CWP4.pdb.gz	LY6K_MOUSE Lymphocyte antigen 6K OS=Mus musculus OX=10090 GN=Ly6k PE=1 SV=1
6	AFDB:P57096	0.680	0.647	1.493E-7	123	0.310	0.293	P57096.pdb.gz	PSCA_MOUSE Prostate stem cell antigen OS=Mus musculus OX=10090 GN=Psca PE=1 SV=2
7	AFDB:Q16553	0.579	0.524	1.583E-7	131	0.328	0.290	Q16553.pdb.gz	LY6E_HUMAN Lymphocyte antigen 6E OS=Homo sapiens OX=9606 GN=LY6E PE=1 SV=1
8	AFDB:A0A1D5P7D9	0.636	0.594	2.997E-7	126	0.293	0.270	A0A1D5P7D9.pdb.gz
9	AFDB:Q64253	0.571	0.506	9.033E-7	136	0.259	0.221	Q64253.pdb.gz	LY6E_MOUSE Lymphocyte antigen 6E OS=Mus musculus OX=10090 GN=Ly6e PE=1 SV=3
10	AFDB:P0CW02	0.554	0.507	2.158E-6	131	0.259	0.229	P0CW02.pdb.gz	LY6C1_MOUSE Lymphocyte antigen 6C1 OS=Mus musculus OX=10090 GN=Ly6c1 PE=2 SV=1
11	PDB:2n99A	0.473	0.694	6.592E-4	76	0.190	0.289	2n99A.pdb.gz
12	PDB:6wjcC	0.403	0.621	2.364E-3	69	0.138	0.232	6wjcC.pdb.gz	Structure and selectivity engineering of the M1muscarinic receptor toxin complex.
13	PDB:6zzeA	0.475	0.641	7.552E-3	82	0.207	0.293	6zzeA.pdb.gz
14	PDB:4zqyA	0.371	0.621	1.273E-2	65	0.112	0.200	4zqyA.pdb.gz
15	PDB:3vtsA	0.419	0.738	2.276E-2	61	0.138	0.262	3vtsA.pdb.gz
16	PDB:6rc7A	0.416	0.736	1.091E-1	60	0.121	0.233	6rc7A.pdb.gz
17	PDB:3bt1U	0.386	0.184	2.321E-1	273	0.121	0.051	3bt1U.pdb.gz
18	PDB:3laqV	0.397	0.195	6.601E-1	260	0.155	0.069	3laqV.pdb.gz
19	PDB:5xbtA	0.221	0.104	1.771	271	0.052	0.022	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
20	PDB:5ye5A	0.156	0.051	1.989	464	0.138	0.034	5ye5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DP58	1.23e-81	236	116	1.000	1.000	LYNX1_HUMAN Ly-6/neurotoxin-like protein 1 OS=Homo sapiens OX=9606 GN=LYNX1 PE=1 SV=1
2	P0DP60	1.99e-66	197	116	0.810	0.810	LYNX1_MOUSE Ly-6/neurotoxin-like protein 1 OS=Mus musculus OX=10090 GN=Lynx1 PE=1 SV=1
3	P35459	2.57e-07	47.8	127	0.319	0.291	LY6D_MOUSE Lymphocyte antigen 6D OS=Mus musculus OX=10090 GN=Ly6d PE=1 SV=1
4	Q9CWP4	2.87e-07	48.1	154	0.293	0.221	LY6K_MOUSE Lymphocyte antigen 6K OS=Mus musculus OX=10090 GN=Ly6k PE=1 SV=1
5	Q14210	2.33e-06	45.4	128	0.293	0.266	LY6D_HUMAN Lymphocyte antigen 6D OS=Homo sapiens OX=9606 GN=LY6D PE=1 SV=1
6	P0DP59	1.24e-05	42.7	97	0.293	0.351	SLUR2_MOUSE Secreted Ly-6/uPAR domain-containing protein 2 OS=Mus musculus OX=10090 GN=Slurp2 PE=2 SV=1
7	P57096	7.20e-05	41.2	123	0.276	0.260	PSCA_MOUSE Prostate stem cell antigen OS=Mus musculus OX=10090 GN=Psca PE=1 SV=2
8	Q9WU67	4.56e-04	39.3	134	0.284	0.246	LY6I_MOUSE Lymphocyte antigen 6I OS=Mus musculus OX=10090 GN=Ly6i PE=2 SV=1
9	O43653	0.009	35.4	114	0.224	0.228	PSCA_HUMAN Prostate stem cell antigen OS=Homo sapiens OX=9606 GN=PSCA PE=1 SV=2
10	Q16553	0.019	35.0	131	0.267	0.237	LY6E_HUMAN Lymphocyte antigen 6E OS=Homo sapiens OX=9606 GN=LY6E PE=1 SV=1
11	Q09098	0.022	34.3	99	0.233	0.273	PATE4_MOUSE Prostate and testis expressed protein 4 OS=Mus musculus OX=10090 GN=Pate4 PE=1 SV=3
12	Q64253	0.028	34.7	136	0.259	0.221	LY6E_MOUSE Lymphocyte antigen 6E OS=Mus musculus OX=10090 GN=Ly6e PE=1 SV=3
13	O01514	0.033	35.0	744	0.129	0.020	PTHB1_CAEEL Protein pthb1 homolog OS=Caenorhabditis elegans OX=6239 GN=bbs-9 PE=1 SV=5
14	Q90986	0.065	33.5	126	0.267	0.246	LY6E_CHICK Lymphocyte antigen 6E OS=Gallus gallus OX=9031 GN=LY6E PE=2 SV=1
15	Q8NI32	0.099	33.5	183	0.267	0.169	LPD6B_HUMAN Ly6/PLAUR domain-containing protein 6B OS=Homo sapiens OX=9606 GN=LYPD6B PE=1 SV=1
16	P13987	0.14	32.7	128	0.276	0.250	CD59_HUMAN CD59 glycoprotein OS=Homo sapiens OX=9606 GN=CD59 PE=1 SV=1
17	Q86Y78	0.18	32.3	171	0.233	0.158	LYPD6_HUMAN Ly6/PLAUR domain-containing protein 6 OS=Homo sapiens OX=9606 GN=LYPD6 PE=1 SV=1
18	P0DP57	0.31	31.2	97	0.250	0.299	SLUR2_HUMAN Secreted Ly-6/uPAR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SLURP2 PE=1 SV=1
19	P79689	0.34	32.0	505	0.138	0.032	P79689_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=axis PE=2 SV=1
20	Q99445	0.47	31.2	158	0.233	0.171	GML_HUMAN Glycosyl-phosphatidylinositol-anchored molecule-like protein OS=Homo sapiens OX=9606 GN=GML PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00087 Toxin_TOLIP	0.0063	28.0	Snake toxin and toxin-like protein
2	PF00021 UPAR_LY6	14	17.8	u-PAR/Ly-6 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000035291

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000035294	0.671	Secreted LY6/PLAUR domain containing 2
2	9598.ENSPTRP00000021417	0.613	LY6/PLAUR domain containing 6
3	9598.ENSPTRP00000007598	0.598	Acrosomal vesicle protein 1
4	9598.ENSPTRP00000035289	0.593	Uncharacterized protein
5	9598.ENSPTRP00000014528	0.592	Nucleoredoxin
6	9598.ENSPTRP00000035296	0.591	Lymphocyte antigen 6 complex, locus D
7	9598.ENSPTRP00000059754	0.591	BCL2-like 13 (Apoptosis facilitator)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0030548	0.998	acetylcholine receptor regulator activity
GO:0005102	0.965	signaling receptor binding
GO:0030547	0.664	signaling receptor inhibitor activity
GO:0030550	0.570	acetylcholine receptor inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.957	regulation of cellular process
GO:0099601	0.886	regulation of neurotransmitter receptor activity
GO:0009987	0.634	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.437	organelle
GO:0043227	0.300	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]