StarFunc result for job id P0DPB6

User Input

>input (133 residues)
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIM
KNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKD
YKDQKASRNESTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DPB6	1.000	1.000	7.500E-24	133	1.000	1.000	P0DPB6.pdb.gz	RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1
2	PDB:7vbaK	0.767	0.940	2.211E-17	108	0.805	0.991	7vbaK.pdb.gz	Structure of the human RNA polymerase I elongation complex.
3	AFDB:Q6DRI4	0.798	0.944	1.435E-15	112	0.549	0.652	Q6DRI4.pdb.gz	RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio OX=7955 GN=polr1d PE=3 SV=1
4	AFDB:Q09177	0.694	0.737	2.716E-11	125	0.361	0.384	Q09177.pdb.gz	RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc19 PE=1 SV=1
5	AFDB:P28000	0.693	0.650	3.717E-11	142	0.391	0.366	P28000.pdb.gz	RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC19 PE=1 SV=1
6	PDB:7aocK	0.662	0.917	1.522E-10	95	0.346	0.484	7aocK.pdb.gz	Conserved strategies of RNA polymerase I hibernation and activation.
7	AFDB:Q9VIZ0	0.734	0.923	1.675E-10	105	0.293	0.371	Q9VIZ0.pdb.gz	RPAC2_DROME Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Drosophila melanogaster OX=7227 GN=l(2)37Cg PE=1 SV=1
8	PDB:6eu1K	0.690	0.874	1.956E-10	104	0.361	0.462	6eu1K.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
9	AFDB:Q384D9	0.721	0.716	6.658E-10	134	0.271	0.269	Q384D9.pdb.gz	Q384D9_TRYB2 DNA-dependent RNA polymerases, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0625 PE=3 SV=1
10	AFDB:O08740	0.723	0.818	1.706E-9	117	0.226	0.256	O08740.pdb.gz	RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus OX=10090 GN=Polr2j PE=1 SV=1
11	AFDB:Q38859	0.735	0.839	2.486E-9	116	0.195	0.224	Q38859.pdb.gz	NRPBB_ARATH DNA-directed RNA polymerases II, IV and V subunit 11 OS=Arabidopsis thaliana OX=3702 GN=NRPB11 PE=1 SV=1
12	AFDB:Q9VJE4	0.725	0.820	2.486E-9	117	0.233	0.265	Q9VJE4.pdb.gz	RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster OX=7227 GN=Polr2J PE=1 SV=1
13	PDB:5iy6K	0.689	0.777	4.795E-9	117	0.226	0.256	5iy6K.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
14	AFDB:P38902	0.760	0.839	1.052E-8	120	0.195	0.217	P38902.pdb.gz	RPB11_YEAST DNA-directed RNA polymerase II subunit RPB11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB11 PE=1 SV=1
15	PDB:3i4mK	0.675	0.769	1.084E-8	116	0.203	0.233	3i4mK.pdb.gz	Molecular basis of transcriptional mutagenesis at 8-oxoguanine
16	PDB:7eu1K	0.670	0.905	4.587E-8	97	0.180	0.247	7eu1K.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
17	PDB:7ok0L	0.642	0.936	1.175E-7	90	0.165	0.244	7ok0L.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
18	PDB:2pa8L	0.628	0.891	9.315E-7	92	0.143	0.207	2pa8L.pdb.gz	The X-ray crystal structure of RNA polymerase from Archaea.
19	PDB:3h0gK	0.701	0.776	1.857E-6	119	0.165	0.185	3h0gK.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
20	PDB:6zyeA	0.328	0.221	5.453E-2	222	0.105	0.063	6zyeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DPB6	1.75e-98	280	133	1.000	1.000	RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1
2	P97304	2.31e-88	254	133	0.902	0.902	RPAC2_MOUSE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Mus musculus OX=10090 GN=Polr1d PE=1 SV=1
3	Q6DRI4	1.81e-49	155	112	0.549	0.652	RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio OX=7955 GN=polr1d PE=3 SV=1
4	P28000	7.06e-32	112	142	0.406	0.380	RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC19 PE=1 SV=1
5	Q09177	2.98e-30	107	125	0.346	0.368	RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc19 PE=1 SV=1
6	Q9VIZ0	1.52e-20	82.0	105	0.278	0.352	RPAC2_DROME Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Drosophila melanogaster OX=7227 GN=l(2)37Cg PE=1 SV=1
7	Q384D9	9.62e-15	67.8	134	0.271	0.269	Q384D9_TRYB2 DNA-dependent RNA polymerases, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0625 PE=3 SV=1
8	P52435	1.23e-14	67.4	117	0.256	0.291	RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens OX=9606 GN=POLR2J PE=1 SV=1
9	O08740	1.28e-14	67.0	117	0.256	0.291	RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus OX=10090 GN=Polr2j PE=1 SV=1
10	Q9VJE4	3.04e-14	66.2	117	0.263	0.299	RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster OX=7227 GN=Polr2J PE=1 SV=1
11	Q9H1A7	5.63e-11	57.8	115	0.226	0.261	RPB1C_HUMAN DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens OX=9606 GN=POLR2J3 PE=1 SV=1
12	Q38859	9.92e-11	57.0	116	0.226	0.259	NRPBB_ARATH DNA-directed RNA polymerases II, IV and V subunit 11 OS=Arabidopsis thaliana OX=3702 GN=NRPB11 PE=1 SV=1
13	Q386T9	6.11e-10	55.5	132	0.218	0.220	Q386T9_TRYB2 DNA-directed RNA polymerase II, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.57.0004 PE=3 SV=1
14	A8MRK9	1.04e-08	52.4	139	0.188	0.180	A8MRK9_ARATH RNApolymerase 14 kDa subunit OS=Arabidopsis thaliana OX=3702 GN=RPC14 PE=1 SV=1
15	P46217	4.68e-08	49.7	90	0.165	0.244	RPO11_SULAC DNA-directed RNA polymerase subunit Rpo11 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo11 PE=1 SV=1
16	P38902	1.38e-07	48.9	120	0.233	0.258	RPB11_YEAST DNA-directed RNA polymerase II subunit RPB11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB11 PE=1 SV=1
17	Q980K0	3.91e-05	42.0	92	0.150	0.217	RPO11_SACS2 DNA-directed RNA polymerase subunit Rpo11 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo11 PE=1 SV=1
18	B8YB62	4.03e-05	42.0	92	0.158	0.228	RPO11_SACSH DNA-directed RNA polymerase subunit Rpo11 OS=Saccharolobus shibatae OX=2286 GN=rpo11 PE=1 SV=1
19	F4J5R0	1.62e-04	41.2	146	0.165	0.151	F4J5R0_ARATH DNA-directed RNA polymerase, RBP11-like protein OS=Arabidopsis thaliana OX=3702 GN=NRPB11 PE=1 SV=1
20	P87123	4.95e-04	39.7	123	0.135	0.146	RPB11_SCHPO DNA-directed RNA polymerase II subunit RPB11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01193 RNA_pol_L	7.1e-12	56.3	RNA polymerase Rpb3/Rpb11 dimerisation domain
2	PF13656 RNA_pol_L_2	1.1e-24	97.3	RNA polymerase Rpb3/Rpb11 dimerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000424

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001458	0.998	Polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
2	61853.ENSNLEP00000004920	0.998	Polymerase (RNA) I polypeptide C, 30kDa
3	61853.ENSNLEP00000005966	0.998	DNA-directed RNA polymerase subunit
4	61853.ENSNLEP00000007793	0.998	Uncharacterized protein
5	61853.ENSNLEP00000020227	0.998	TWIST neighbor
6	61853.ENSNLEP00000010593	0.997	Polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
7	61853.ENSNLEP00000011925	0.997	DNA-directed RNA polymerase III subunit RPC6
8	61853.ENSNLEP00000018858	0.996	Polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)
9	61853.ENSNLEP00000002049	0.995	DNA-directed RNA polymerase subunit beta
10	61853.ENSNLEP00000018225	0.995	Polymerase (RNA) II (DNA directed) polypeptide F
11	61853.ENSNLEP00000003002	0.993	DNA-directed RNA polymerase subunit
12	61853.ENSNLEP00000012786	0.993	DNA-directed RNA polymerase subunit
13	61853.ENSNLEP00000018840	0.993	Polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
14	61853.ENSNLEP00000008144	0.992	DNA-directed RNA polymerase subunit beta
15	61853.ENSNLEP00000001712	0.991	CGRP receptor component
16	61853.ENSNLEP00000006857	0.990	Polymerase (RNA) III (DNA directed) polypeptide C (62kD)
17	61853.ENSNLEP00000004371	0.988	Polymerase (RNA) I polypeptide E, 53kDa
18	61853.ENSNLEP00000003627	0.979	annotation not available
19	61853.ENSNLEP00000022436	0.979	Uncharacterized protein
20	61853.ENSNLEP00000009687	0.975	DNA-directed RNA polymerase subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.605	catalytic activity
GO:0016740	0.424	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0048856	0.966	anatomical structure development
GO:0071704	0.964	organic substance metabolic process
GO:0044238	0.963	primary metabolic process
GO:0044237	0.959	cellular metabolic process
GO:0006807	0.951	nitrogen compound metabolic process
GO:0043170	0.919	macromolecule metabolic process
GO:0006139	0.915	nucleobase-containing compound metabolic process
GO:0090304	0.810	nucleic acid metabolic process
GO:0016070	0.791	RNA metabolic process
GO:0032501	0.764	multicellular organismal process
GO:1904888	0.692	cranial skeletal system development
GO:0010467	0.630	gene expression
GO:0034654	0.620	nucleobase-containing compound biosynthetic process
GO:0071840	0.604	cellular component organization or biogenesis
GO:0009059	0.599	macromolecule biosynthetic process
GO:0006351	0.570	DNA-templated transcription
GO:0007275	0.561	multicellular organism development
GO:0001501	0.474	skeletal system development
GO:0048705	0.397	skeletal system morphogenesis
GO:0044085	0.387	cellular component biogenesis
GO:0009790	0.382	embryo development
GO:0048706	0.366	embryonic skeletal system development
GO:0022613	0.364	ribonucleoprotein complex biogenesis
GO:0050789	0.320	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0055029	0.997	nuclear DNA-directed RNA polymerase complex
GO:0005730	0.993	nucleolus
GO:0005736	0.610	RNA polymerase I complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.424	Transferases.

[back to server]