StarFunc result for job id P0DPD7

User Input

>input (255 residues)
MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPED
RILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFP
SASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSEVSRVLVPGGRFISMTSAAPH
FRTRHYAQAYYGWSLRHATYGSGFHFHLYLMHKGGKLSVAQLALGAQILSPPRPPTSPCF
LQDSDHEDFLSAIQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DPD7	1.000	1.000	2.450E-55	255	1.000	1.000	P0DPD7.pdb.gz	EFMT4_HUMAN EEF1A lysine methyltransferase 4 OS=Homo sapiens OX=9606 GN=EEF1AKMT4 PE=1 SV=1
2	AFDB:P0DPE2	0.604	0.178	1.533E-23	883	0.533	0.154	P0DPE2.pdb.gz	EFCE2_BOVIN EEF1AKMT4-ECE2 readthrough transcript protein OS=Bos taurus OX=9913 GN=EEF1AKMT4-ECE2 PE=1 SV=1
3	AFDB:Q8N6R0	0.724	0.273	1.031E-20	699	0.263	0.096	Q8N6R0.pdb.gz	EFNMT_HUMAN eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=METTL13 PE=1 SV=1
4	AFDB:Q57XQ9	0.680	0.683	9.826E-19	254	0.263	0.264	Q57XQ9.pdb.gz	Q57XQ9_TRYB2 Methyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.580 PE=4 SV=1
5	AFDB:Q17539	0.716	0.290	1.402E-18	656	0.251	0.098	Q17539.pdb.gz	Q17539_CAEEL Methyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C01B10.8 PE=1 SV=1
6	AFDB:A8MUP2	0.678	0.718	2.170E-14	240	0.255	0.271	A8MUP2.pdb.gz	CSKMT_HUMAN Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial OS=Homo sapiens OX=9606 GN=CSKMT PE=1 SV=1
7	AFDB:A0A494BZY7	0.643	0.691	1.633E-12	236	0.173	0.186	A0A494BZY7.pdb.gz	A0A494BZY7_HUMAN EEF1A lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EEF1AKMT2 PE=1 SV=1
8	AFDB:Q9C9M1	0.567	0.413	4.792E-10	358	0.212	0.151	Q9C9M1.pdb.gz	Q9C9M1_ARATH Protein-lysine N-methyltransferase At1g66680 OS=Arabidopsis thaliana OX=3702 GN=AR401 PE=1 SV=1
9	AFDB:Q9P7Z3	0.580	0.617	7.252E-10	238	0.196	0.210	Q9P7Z3.pdb.gz	EFM4_SCHPO Protein-lysine N-methyltransferase efm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=see1 PE=2 SV=1
10	AFDB:P40516	0.615	0.611	1.097E-9	257	0.169	0.167	P40516.pdb.gz	EFM4_YEAST Protein-lysine N-methyltransferase EFM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFM4 PE=1 SV=1
11	PDB:7bggA	0.515	0.597	4.007E-8	216	0.149	0.176	7bggA.pdb.gz	Structural basis of O-methylation of (2-heptyl-)1-hydroxyquinolin-4(1H)-one and related compounds by the heterocyclic toxin methyltransferase Rv0560c of Mycobacterium tuberculosis.
12	PDB:7ezgA	0.493	0.461	6.064E-8	275	0.157	0.145	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
13	PDB:4a6dA	0.487	0.376	9.177E-8	345	0.145	0.107	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
14	PDB:7wttq	0.493	0.530	1.234E-7	235	0.169	0.183	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:3vc1D	0.484	0.433	1.760E-7	288	0.153	0.135	3vc1D.pdb.gz	Structure of Geranyl Diphosphate C-Methyltransferase from Streptomyces coelicolor and Implications for the Mechanism of Isoprenoid Modification.
16	PDB:5wp4A	0.469	0.266	1.760E-7	485	0.133	0.070	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
17	PDB:5wp5A	0.465	0.267	1.981E-7	463	0.137	0.076	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
18	PDB:7of5C	0.448	0.353	2.230E-7	338	0.161	0.121	7of5C.pdb.gz	Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
19	PDB:2xvaA	0.460	0.567	2.510E-7	199	0.141	0.181	2xvaA.pdb.gz	Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
20	PDB:5mgzA	0.474	0.521	2.663E-7	230	0.153	0.170	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DPD7	0.0	524	255	1.000	1.000	EFMT4_HUMAN EEF1A lysine methyltransferase 4 OS=Homo sapiens OX=9606 GN=EEF1AKMT4 PE=1 SV=1
2	P0DPE2	6.68e-90	286	883	0.533	0.154	EFCE2_BOVIN EEF1AKMT4-ECE2 readthrough transcript protein OS=Bos taurus OX=9913 GN=EEF1AKMT4-ECE2 PE=1 SV=1
3	Q8N6R0	3.46e-32	126	699	0.255	0.093	EFNMT_HUMAN eEF1A lysine and N-terminal methyltransferase OS=Homo sapiens OX=9606 GN=METTL13 PE=1 SV=1
4	Q91YR5	1.76e-31	124	698	0.247	0.090	EFNMT_MOUSE eEF1A lysine and N-terminal methyltransferase OS=Mus musculus OX=10090 GN=Mettl13 PE=1 SV=1
5	Q57XQ9	1.35e-24	100	254	0.263	0.264	Q57XQ9_TRYB2 Methyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.580 PE=4 SV=1
6	Q17539	2.03e-24	103	656	0.224	0.087	Q17539_CAEEL Methyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C01B10.8 PE=1 SV=1
7	A8MUP2	5.14e-11	63.2	240	0.231	0.246	CSKMT_HUMAN Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial OS=Homo sapiens OX=9606 GN=CSKMT PE=1 SV=1
8	A0A494BZY7	2.54e-06	49.3	236	0.188	0.203	A0A494BZY7_HUMAN EEF1A lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EEF1AKMT2 PE=1 SV=1
9	Q5JPI9	2.60e-06	49.7	291	0.188	0.165	EFMT2_HUMAN EEF1A lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EEF1AKMT2 PE=1 SV=2
10	P9WK03	6.42e-06	47.8	197	0.137	0.178	Y089_MYCTU Uncharacterized methyltransferase Rv0089 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0089 PE=3 SV=1
11	Q9P7Z3	5.77e-05	45.4	238	0.180	0.193	EFM4_SCHPO Protein-lysine N-methyltransferase efm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=see1 PE=2 SV=1
12	Q9C9M1	1.33e-04	44.7	358	0.137	0.098	Q9C9M1_ARATH Protein-lysine N-methyltransferase At1g66680 OS=Arabidopsis thaliana OX=3702 GN=AR401 PE=1 SV=1
13	P40516	4.64e-04	42.7	257	0.173	0.171	EFM4_YEAST Protein-lysine N-methyltransferase EFM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFM4 PE=1 SV=1
14	Q9CXI0	0.010	39.3	327	0.114	0.089	COQ5_MOUSE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq5 PE=1 SV=2
15	O53285	0.025	37.7	327	0.157	0.122	O53285_MYCTO Methyltransferase type 11 domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3123 PE=4 SV=1
16	O07251	0.054	35.8	151	0.118	0.199	O07251_MYCTU Methyltransferase domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0326 PE=4 SV=1
17	O74529	0.066	36.2	260	0.137	0.135	YJ48_SCHPO Uncharacterized methyltransferase C70.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC70.08c PE=3 SV=1
18	P9WLL9	0.078	36.6	407	0.110	0.069	Y2067_MYCTU Uncharacterized protein Rv2067c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2067c PE=1 SV=1
19	A0A482NB13	0.13	35.4	292	0.153	0.134	ICCD_TALVA S-adenosyl-L-methionine-dependent Diels-Alderase iccD OS=Talaromyces variabilis OX=28576 GN=iccD PE=1 SV=1
20	A4FG18	0.16	35.4	285	0.129	0.116	GPPMT_SACEN Geranyl diphosphate 2-C-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_3721 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	2.2e-10	52.4	Methyltransferase domain
2	PF08242 Methyltransf_12	5.4e-05	35.2	Methyltransferase domain
3	PF13489 Methyltransf_23	0.11	23.8	Methyltransferase domain
4	PF13649 Methyltransf_25	2.1e-08	46.0	Methyltransferase domain
5	PF13847 Methyltransf_31	2.7e-06	38.8	Methyltransferase domain
6	PF07021 MetW	4.4e+02	11.9	Methionine biosynthesis protein MetW
7	PF05401 NodS	4e+02	12.2	Nodulation protein S (NodS)
8	PF00398 RrnaAD	5.8e+02	10.9	Ribosomal RNA adenine dimethylase
9	PF01209 Ubie_methyltran	34	15.2	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008953562.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806630.1	0.633	Endothelin converting enzyme 2
2	9597.XP_008970932.1	0.516	Probable inactive tRNA-specific adenosine deaminase-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016279	0.998	protein-lysine N-methyltransferase activity
GO:0005488	0.964	binding
GO:0005515	0.888	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.975	metabolic process
GO:0009987	0.921	cellular process
GO:0071704	0.901	organic substance metabolic process
GO:0006807	0.893	nitrogen compound metabolic process
GO:0065007	0.851	biological regulation
GO:0044238	0.832	primary metabolic process
GO:1901564	0.818	organonitrogen compound metabolic process
GO:0043170	0.773	macromolecule metabolic process
GO:0044237	0.736	cellular metabolic process
GO:0050789	0.700	regulation of biological process
GO:0050794	0.609	regulation of cellular process
GO:0043412	0.585	macromolecule modification
GO:0019222	0.383	regulation of metabolic process
GO:0019538	0.362	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005654	0.986	nucleoplasm
GO:0005829	0.807	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	0.998	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]