StarFunc result for job id P0DPF3

User Input

>input (1111 residues)
MVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFGNLKERCFLTQLAGFLANRQKKYKY
EECKDLIKFMLRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLKEKLREGRDAS
RSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDEDEDEDVQVEEDE
KVLESSAPREVQKAEESKVAEDSLEECAITCSNSHGPCDSNQPHKNIKITFEEDEVNSTL
VVDRESSHDECQDALNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNILEINEKLRPQLA
EKKQQFRNLKEKCFLTQLAGFLANQQNKYKYEECKDLIKFMLRNERQFKEEKLAEQLKQA
EELRQYKVLVHAQERELTQLREKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLA
EGCRLAQHLVQKLSPENDNDDDEDVQIEVAEKVQKSSAPREMQKAEEKEVPEDSLEECAI
TYSNSHGPYDSNQPHRKTKITFEEDKVDSTLIGSSSHVEREDAVHIIPENESDDEEEEEK
GPVSPRNLQESEEEEVPQESWDEGYSTPSIPPEMLASYKSYSSTFHSLEEQQVCMAVDIG
RHRWDQVKKEDQEATGPRLSRELLDEKGPEVLQDSLDRCYSTPSGCLELTDSCQPYRSAF
YVLEQQRVGLAVDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPEVLQDSLGRWYSTPSG
YLELPDLGQPYSSAVYSLEEQYLGLALDLDRIKKDQEEEEDQGPPCPRLSRELLEVVEPE
VLQDSLDRCYSTPSSCLEQPDSCQPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRR
SKKKRRRGRKEGEENQNPPCPRLSRELLDEKEPEVLQDSLDRCYSTPSGYLELPDLGQPY
SSAVYSLEEQYLGLALDVDRIKKDQEEEEDQGPPCPRLSRELLEVVEPEVLQDSLDRCYS
TPSSCLEQPDSCQPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKERRRGRKE
GEEDQNPPCPRLNGVLMEVEEPEVLQDSLDGCYSTPSMYFELPDSFQHYRSVFYSFEEQH
ISFALYVDNRFFTLTVTSLHLVFQMEVIFPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DPF3	1.000	1.000	0.000	1111	1.000	1.000	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
2	AFDB:Q3BBV0	0.240	0.221	4.728E-97	1214	0.805	0.736	Q3BBV0.pdb.gz	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
3	AFDB:Q6P3W6	0.315	0.407	1.448E-96	841	0.734	0.970	Q6P3W6.pdb.gz	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
4	AFDB:A0A2K7P776	0.261	0.329	1.118E-91	867	0.709	0.909	A0A2K7P776.pdb.gz	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
5	AFDB:Q5TI25	0.094	0.113	4.736E-72	921	0.678	0.818	Q5TI25.pdb.gz	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
6	AFDB:E1C2F2	0.083	0.124	3.084E-5	691	0.091	0.146	E1C2F2.pdb.gz	E1C2F2_CHICK Pinin OS=Gallus gallus OX=9031 GN=PNN PE=1 SV=3
7	AFDB:Q5YL88	0.061	0.057	3.084E-5	1205	0.142	0.131	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
8	AFDB:Q70EL1	0.053	0.038	7.038E-5	1684	0.145	0.096	Q70EL1.pdb.gz	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
9	AFDB:Q6XZL8	0.050	0.038	1.514E-4	1540	0.152	0.110	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
10	AFDB:Q17602	0.074	0.061	2.033E-4	1390	0.117	0.094	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
11	PDB:2p22C	0.045	0.225	1.559E-1	186	0.026	0.156	2p22C.pdb.gz
12	PDB:7rroD1	0.075	0.171	4.775E-1	425	0.022	0.056	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:7rroA1	0.079	0.168	5.064E-1	396	0.050	0.141	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:7ungB0	0.069	0.308	9.129E-1	193	0.018	0.104	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:1yo7A	0.046	0.378	1.027	120	0.014	0.133	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
16	PDB:1ek8A	0.045	0.190	1.300	185	0.014	0.081	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
17	PDB:7ungD2	0.083	0.214	1.463	398	0.020	0.055	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:6k1zA	0.069	0.123	1.646	544	0.020	0.040	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
19	PDB:1qsdA	0.043	0.289	1.964	102	0.020	0.216	1qsdA.pdb.gz
20	PDB:3euhB	0.045	0.132	1.964	321	0.023	0.078	3euhB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUL8	0.0	1214	3843	0.642	0.186	NBPFJ_HUMAN Neuroblastoma breakpoint family member 19 OS=Homo sapiens OX=9606 GN=NBPF19 PE=5 SV=1
2	A0A2K7P776	0.0	1303	867	0.650	0.833	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
3	P0DPF2	0.0	617	5207	0.342	0.073	NBPFK_HUMAN Neuroblastoma breakpoint family member 20 OS=Homo sapiens OX=9606 GN=NBPF20 PE=3 SV=1
4	P0DPF3	0.0	2246	1111	1.000	1.000	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
5	Q3BBV0	0.0	1538	1214	0.759	0.694	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
6	Q5TI25	0.0	1137	921	0.588	0.709	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
7	Q6P3W6	0.0	1733	3795	0.876	0.256	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
8	Q5VU43	3.85e-10	67.0	2346	0.052	0.025	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
9	B7ZNY0	2.88e-09	64.3	2412	0.054	0.025	B7ZNY0_MOUSE Pde4dip protein OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=1
10	Q80YT7	5.51e-09	63.2	2224	0.050	0.025	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
11	Q9WUJ3	0.19	38.5	2324	0.029	0.014	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
12	M9PI41	0.33	37.7	1858	0.053	0.032	M9PI41_DROME Sticky, isoform B OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=1
13	Q9VTY8	0.33	37.7	1854	0.053	0.032	Q9VTY8_DROME FI02033p OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=2
14	Q8QZV7	3.1	34.3	732	0.021	0.031	INT13_MOUSE Integrator complex subunit 13 OS=Mus musculus OX=10090 GN=IntS13 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14617 CMS1	7.7	17.4	U3-containing 90S pre-ribosomal complex subunit
2	PF05842 Euplotes_phero	15	17.6	Euplotes octocarinatus mating pheromone protein
3	PF03127 GAT	0.38	22.4	GAT domain
4	PF06758 Olduvai	2.6e-212	698.7	Olduvai domain
5	PF07521 RMMBL	2.3e+02	13.2	Zn-dependent metallo-hydrolase RNA specificity domain
6	PF18335 SH3_13	3.6e+02	12.4	ATP-dependent RecD-like DNA helicase SH3 domain
7	PF06122 TraH	5.7e+02	11.2	Conjugative relaxosome accessory transposon protein
8	PF00110 wnt	67	14.4	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430853	0.603	Nuclear pore complex interacting protein family member B11
2	9606.ENSP00000464060	0.560	Notch homolog 2 N-terminal-like protein
3	9606.ENSP00000414909	0.525	Uncharacterized protein C1orf167
4	9606.ENSP00000377369	0.503	Leucine-rich repeat-containing protein 74A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.870	cellular process
GO:0065007	0.849	biological regulation
GO:0050789	0.771	regulation of biological process
GO:0050794	0.710	regulation of cellular process
GO:0048518	0.442	positive regulation of biological process
GO:0048522	0.389	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043227	0.965	membrane-bounded organelle
GO:0043231	0.931	intracellular membrane-bounded organelle
GO:0016020	0.929	membrane
GO:0071944	0.886	cell periphery
GO:0043232	0.876	intracellular non-membrane-bounded organelle
GO:0005856	0.853	cytoskeleton
GO:0005634	0.616	nucleus
GO:0070013	0.606	intracellular organelle lumen
GO:0031981	0.530	nuclear lumen
GO:0005886	0.404	plasma membrane
GO:0005654	0.383	nucleoplasm
GO:0012505	0.308	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]