StarFunc result for job id P0DPK2

User Input

>input (136 residues)
MARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQ
LLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTI
MPRDMQLARRLRREGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DPK5	0.734	0.680	2.847E-18	147	0.971	0.898	P0DPK5.pdb.gz	H3Y2_HUMAN Histone H3.X OS=Homo sapiens OX=9606 GN=H3Y2 PE=5 SV=1
2	AFDB:P07041	0.873	0.873	7.639E-17	136	0.772	0.772	P07041.pdb.gz	H3_NEUCR Histone H3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=hh3 PE=1 SV=3
3	AFDB:A8MRL0	0.832	0.697	1.055E-16	164	0.787	0.652	A8MRL0.pdb.gz	A8MRL0_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=H33 PE=3 SV=1
4	AFDB:O15819	0.857	0.840	4.359E-16	139	0.743	0.727	O15819.pdb.gz	H33A_DICDI Histone H3.3 type a OS=Dictyostelium discoideum OX=44689 GN=H3a PE=1 SV=1
5	AFDB:Q55BN9	0.870	0.870	1.305E-15	136	0.706	0.706	Q55BN9.pdb.gz	H33B_DICDI Histone H3.3 type b OS=Dictyostelium discoideum OX=44689 GN=H3b PE=1 SV=1
6	PDB:1kx5A	0.773	0.779	2.847E-14	135	0.779	0.785	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
7	PDB:5ay8A	0.705	0.986	3.037E-14	97	0.713	1.000	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
8	AFDB:Q6T367	0.716	0.595	7.894E-12	164	0.566	0.470	Q6T367.pdb.gz	CENH3_ORYSJ Histone H3-like centromeric protein CENH3 OS=Oryza sativa subsp. japonica OX=39947 GN=CENH3 PE=2 SV=1
9	AFDB:Q9Y812	0.699	0.790	1.162E-11	120	0.507	0.575	Q9Y812.pdb.gz	CENPA_SCHPO Histone H3-like centromeric protein cnp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnp1 PE=1 SV=1
10	AFDB:Q4GYX7	0.776	0.792	1.240E-11	133	0.507	0.519	Q4GYX7.pdb.gz	Q4GYX7_TRYB2 Histone H3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.2430 PE=1 SV=1
11	PDB:4jjnA	0.710	0.981	2.487E-11	98	0.551	0.765	4jjnA.pdb.gz	Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
12	AFDB:Q8IDZ1	0.733	0.589	3.959E-11	170	0.478	0.382	Q8IDZ1.pdb.gz	Q8IDZ1_PLAF7 Histone H3-like centromeric protein CSE4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1333700 PE=3 SV=1
13	AFDB:Q387X7	0.722	0.707	6.633E-11	139	0.412	0.403	Q387X7.pdb.gz	Q387X7_TRYB2 Histone H3 variant OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1090 PE=3 SV=1
14	PDB:7on1e	0.640	0.887	1.069E-8	97	0.434	0.608	7on1e.pdb.gz	Cenp-A nucleosome in complex with Cenp-C
15	PDB:4h9sA	0.492	0.728	4.417E-8	89	0.500	0.764	4h9sA.pdb.gz
16	PDB:6e0cA	0.639	0.872	7.400E-8	99	0.390	0.535	6e0cA.pdb.gz	Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
17	PDB:7xayD	0.539	0.746	8.980E-8	97	0.537	0.753	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.
18	PDB:6xwtA	0.480	0.848	7.500E-4	74	0.228	0.419	6xwtA.pdb.gz
19	PDB:2rvqD	0.456	0.479	2.105E-3	129	0.162	0.171	2rvqD.pdb.gz
20	PDB:5y27A	0.455	0.614	3.761E-3	98	0.110	0.153	5y27A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DPK2	3.71e-95	272	136	1.000	1.000	H3Y1_HUMAN Histone H3.Y OS=Homo sapiens OX=9606 GN=H3Y1 PE=1 SV=1
2	P0DPK5	1.13e-90	261	147	0.971	0.898	H3Y2_HUMAN Histone H3.X OS=Homo sapiens OX=9606 GN=H3Y2 PE=5 SV=1
3	Q9U281	6.62e-77	226	136	0.816	0.816	H332_CAEEL Histone H3.3 type 2 OS=Caenorhabditis elegans OX=6239 GN=his-72 PE=1 SV=3
4	C0HL66	3.39e-76	224	136	0.809	0.809	H33A_DROME Histone H3.3A OS=Drosophila melanogaster OX=7227 GN=His3.3A PE=1 SV=1
5	C0HL67	3.39e-76	224	136	0.809	0.809	H33B_DROME Histone H3.3B OS=Drosophila melanogaster OX=7227 GN=His3.3B PE=1 SV=1
6	C1BEZ2	3.39e-76	224	136	0.809	0.809	C1BEZ2_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
7	P84243	3.39e-76	224	136	0.809	0.809	H33_HUMAN Histone H3.3 OS=Homo sapiens OX=9606 GN=H3-3A PE=1 SV=2
8	P84244	3.39e-76	224	136	0.809	0.809	H33_MOUSE Histone H3.3 OS=Mus musculus OX=10090 GN=H3-3a PE=1 SV=2
9	P84245	3.39e-76	224	136	0.809	0.809	H33_RAT Histone H3.3 OS=Rattus norvegicus OX=10116 GN=H3-3b PE=1 SV=2
10	C1BF09	5.15e-76	223	136	0.801	0.801	C1BF09_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
11	C1BGV2	6.27e-76	223	136	0.801	0.801	C1BGV2_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
12	C1BGA8	1.74e-75	222	136	0.801	0.801	C1BGA8_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
13	C1BG88	2.39e-75	222	136	0.801	0.801	C1BG88_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
14	P02299	3.22e-74	219	136	0.787	0.787	H3_DROME Histone H3 OS=Drosophila melanogaster OX=7227 GN=His3 PE=1 SV=4
15	P84228	3.22e-74	219	136	0.787	0.787	H32_MOUSE Histone H3.2 OS=Mus musculus OX=10090 GN=H3c2 PE=1 SV=2
16	P84233	3.22e-74	219	136	0.787	0.787	H32_XENLA Histone H3.2 OS=Xenopus laevis OX=8355 PE=1 SV=2
17	Q71DI3	3.22e-74	219	136	0.787	0.787	H32_HUMAN Histone H3.2 OS=Homo sapiens OX=9606 GN=H3C15 PE=1 SV=3
18	P59226	5.51e-74	218	136	0.779	0.779	H31_ARATH Histone H3.1 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2
19	P09988	6.86e-74	218	136	0.787	0.787	H31_SCHPO Histone H3.1/H3.2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hht1 PE=1 SV=2
20	P07041	1.82e-73	217	136	0.772	0.772	H3_NEUCR Histone H3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=hh3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	1.9e+02	13.7	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF15630 CENP-S	1.5	20.6	CENP-S protein
3	PF15511 CENP-T_C	0.012	27.1	Centromere kinetochore component CENP-T histone fold
4	PF00125 Histone	1.6e-42	156.2	Core histone H2A/H2B/H3/H4
5	PF15715 PAF	87	15.2	PCNA-associated factor histone like domain
6	PF09072 TMA7	1.3e+02	14.7	Translation machinery associated TMA7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000018899

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000006237	0.980	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
2	9593.ENSGGOP00000010106	0.970	Uncharacterized protein
3	9593.ENSGGOP00000028536	0.951	Belongs to the histone H2B family.
4	9593.ENSGGOP00000009140	0.936	Histone acetyltransferase type B catalytic subunit
5	9593.ENSGGOP00000025737	0.929	Death-domain associated protein
6	9593.ENSGGOP00000003563	0.920	F-box and leucine-rich repeat protein 19
7	9593.ENSGGOP00000025404	0.916	ATRX, chromatin remodeler
8	9593.ENSGGOP00000012906	0.913	Belongs to the histone H2A family.
9	9593.ENSGGOP00000016173	0.913	Histone H2A
10	9593.ENSGGOP00000018935	0.907	Histone cluster 1, H4i
11	9593.ENSGGOP00000019841	0.907	Histone H4
12	9593.ENSGGOP00000020335	0.907	Histone H4
13	9593.ENSGGOP00000020625	0.907	Histone H4
14	9593.ENSGGOP00000021745	0.907	Histone H4
15	9593.ENSGGOP00000021754	0.907	Histone H4
16	9593.ENSGGOP00000024364	0.907	Histone cluster 2, H4a
17	9593.ENSGGOP00000027594	0.907	Histone H4
18	9593.ENSGGOP00000019110	0.875	Death inducer-obliterator 1
19	9593.ENSGGOP00000000040	0.842	Chromobox homolog 5
20	9593.ENSGGOP00000020086	0.826	Belongs to the acetyltransferase family. GCN5 subfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.923	heterocyclic compound binding
GO:0097159	0.923	organic cyclic compound binding
GO:0003676	0.905	nucleic acid binding
GO:0003677	0.893	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006325	0.988	chromatin organization
GO:0050789	0.987	regulation of biological process
GO:0006338	0.958	chromatin remodeling
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0010468	0.943	regulation of gene expression
GO:0050896	0.941	response to stimulus
GO:0050794	0.884	regulation of cellular process
GO:0048519	0.871	negative regulation of biological process
GO:0051276	0.849	chromosome organization
GO:0071704	0.765	organic substance metabolic process
GO:0010605	0.765	negative regulation of macromolecule metabolic process
GO:0043170	0.711	macromolecule metabolic process
GO:0044237	0.697	cellular metabolic process
GO:0006807	0.684	nitrogen compound metabolic process
GO:0010629	0.610	negative regulation of gene expression
GO:0044238	0.579	primary metabolic process
GO:2001141	0.535	regulation of RNA biosynthetic process
GO:0071824	0.505	protein-DNA complex subunit organization
GO:1903506	0.503	regulation of nucleic acid-templated transcription
GO:0048518	0.501	positive regulation of biological process
GO:0006355	0.493	regulation of DNA-templated transcription
GO:0040029	0.488	epigenetic regulation of gene expression
GO:0051716	0.484	cellular response to stimulus
GO:0065004	0.473	protein-DNA complex assembly
GO:0048523	0.466	negative regulation of cellular process
GO:0032502	0.454	developmental process
GO:0032501	0.440	multicellular organismal process
GO:0048856	0.421	anatomical structure development
GO:0006950	0.419	response to stress
GO:0048522	0.383	positive regulation of cellular process
GO:0007275	0.358	multicellular organism development
GO:0034728	0.328	nucleosome organization
GO:0044260	0.315	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0000785	0.998	chromatin
GO:0031981	0.983	nuclear lumen
GO:0005654	0.954	nucleoplasm
GO:0000786	0.927	nucleosome
GO:0000228	0.848	nuclear chromosome
GO:0098687	0.343	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]