StarFunc result for job id P0DPK4

User Input

>input (236 residues)
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGE
DCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC
TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCD
SLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DPK4	1.000	1.000	4.909E-52	236	1.000	1.000	P0DPK4.pdb.gz	NT2NC_HUMAN Notch homolog 2 N-terminal-like protein C OS=Homo sapiens OX=9606 GN=NOTCH2NLC PE=1 SV=2
2	AFDB:O35516	0.384	0.060	1.334E-36	2473	0.805	0.077	O35516.pdb.gz	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
3	AFDB:P21783	0.485	0.061	3.742E-25	2524	0.432	0.040	P21783.pdb.gz	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
4	AFDB:F1QCA7	0.448	0.056	4.507E-25	2465	0.407	0.039	F1QCA7.pdb.gz
5	AFDB:P46530	0.465	0.062	4.507E-25	2437	0.411	0.040	P46530.pdb.gz	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
6	AFDB:F1RCH4	0.496	0.063	3.489E-24	2475	0.445	0.042	F1RCH4.pdb.gz	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
7	AFDB:Q01705	0.417	0.058	2.702E-23	2531	0.428	0.040	Q01705.pdb.gz	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
8	AFDB:Q9IAT6	0.348	0.140	6.438E-23	664	0.339	0.120	Q9IAT6.pdb.gz	DLLC_DANRE Delta-like protein C OS=Danio rerio OX=7955 GN=dlc PE=2 SV=1
9	AFDB:Q90656	0.331	0.124	8.251E-23	728	0.305	0.099	Q90656.pdb.gz	Q90656_CHICK Delta-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
10	AFDB:Q61483	0.352	0.131	1.274E-22	722	0.309	0.101	Q61483.pdb.gz	DLL1_MOUSE Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2
11	PDB:7q3nU	0.209	0.182	3.324E-7	292	0.212	0.171	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:4g1eB	0.197	0.097	3.882E-3	709	0.161	0.054	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
13	PDB:5es4B	0.245	0.108	1.720E-2	674	0.153	0.053	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
14	PDB:4rs0A	0.159	0.069	2.495E-2	557	0.064	0.027	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
15	PDB:5f1aA	0.157	0.068	3.402E-2	553	0.068	0.029	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
16	PDB:4e0sB	0.151	0.042	6.326E-2	898	0.136	0.036	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
17	PDB:7nxdB	0.143	0.074	1.105E-1	690	0.140	0.048	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:6y3cA	0.149	0.064	1.332E-1	557	0.055	0.023	6y3cA.pdb.gz
19	PDB:7nycC	0.137	0.044	1.332E-1	809	0.157	0.046	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:6dlwA	0.120	0.063	1.604E-1	460	0.064	0.033	6dlwA.pdb.gz	The first transmembrane region of complement component-9 acts as a brake on its self-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z3S9	7.73e-174	479	236	1.000	1.000	NT2NA_HUMAN Notch homolog 2 N-terminal-like protein A OS=Homo sapiens OX=9606 GN=NOTCH2NLA PE=1 SV=1
2	P0DPK3	5.86e-173	478	275	0.996	0.855	NT2NB_HUMAN Notch homolog 2 N-terminal-like protein B OS=Homo sapiens OX=9606 GN=NOTCH2NLB PE=1 SV=1
3	P0DPK4	3.26e-172	477	293	1.000	0.805	NT2NC_HUMAN Notch homolog 2 N-terminal-like protein C OS=Homo sapiens OX=9606 GN=NOTCH2NLC PE=1 SV=2
4	Q04721	1.47e-139	434	2471	0.890	0.085	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
5	O35516	3.77e-127	398	2473	0.805	0.077	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
6	Q9QW30	2.34e-123	387	2471	0.784	0.075	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
7	F1RCH4	5.35e-59	203	2475	0.445	0.042	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
8	A2RUV0	1.11e-51	182	2522	0.445	0.042	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
9	P46530	2.81e-51	181	2437	0.415	0.040	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
10	P07207	5.77e-51	180	2703	0.415	0.036	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
11	Q01705	3.32e-50	177	2531	0.424	0.040	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
12	Q07008	5.33e-50	177	2531	0.424	0.040	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
13	A0PGH6	1.55e-49	176	2465	0.407	0.039	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
14	P21783	1.68e-49	176	2524	0.432	0.040	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
15	P46531	1.92e-49	175	2555	0.424	0.039	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
16	G3I6Z6	3.40e-49	174	2527	0.424	0.040	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
17	Q9UM47	5.61e-42	154	2321	0.364	0.037	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
18	Q800E4	6.45e-42	154	2468	0.347	0.033	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
19	Q61982	2.91e-41	152	2318	0.352	0.036	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
20	Q9R172	3.14e-40	149	2319	0.339	0.034	NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.2e+02	14.0	Complement Clr-like EGF-like
2	PF00008 EGF	1.6e-32	122.7	EGF-like domain
3	PF07974 EGF_2	7.9e-06	37.4	EGF-like domain
4	PF12947 EGF_3	6.5e-05	34.3	EGF domain
5	PF07645 EGF_CA	6.8e-06	37.5	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	3.4e+02	13.0	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	1.5e-16	71.5	Human growth factor-like EGF
8	PF00053 Laminin_EGF	24	16.5	Laminin EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.792	Recombining binding protein suppressor of hairless
2	9606.ENSP00000261681	0.657	MAGUK p55 subfamily member 5
3	9606.ENSP00000479693	0.643	Neuroblastoma breakpoint family member 14
4	9606.ENSP00000446224	0.607	Zinc finger protein 550
5	9606.ENSP00000478752	0.601	Neuroblastoma breakpoint family, member 14
6	9606.ENSP00000466090	0.576	Neutrophil elastase
7	9606.ENSP00000477979	0.560	Neuroblastoma breakpoint family member 20
8	9606.ENSP00000260408	0.545	Disintegrin and metalloproteinase domain-containing protein 10
9	9606.ENSP00000293549	0.540	Proto-oncogene Wnt-1
10	9606.ENSP00000363921	0.522	Partitioning defective 3 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0005112	0.985	Notch binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0050794	0.988	regulation of cellular process
GO:0048856	0.987	anatomical structure development
GO:0007275	0.977	multicellular organism development
GO:0048731	0.972	system development
GO:0048518	0.958	positive regulation of biological process
GO:0048522	0.923	positive regulation of cellular process
GO:0009987	0.882	cellular process
GO:0048513	0.837	animal organ development
GO:0007399	0.836	nervous system development
GO:0048584	0.744	positive regulation of response to stimulus
GO:0008593	0.730	regulation of Notch signaling pathway
GO:0009967	0.688	positive regulation of signal transduction
GO:0045747	0.531	positive regulation of Notch signaling pathway
GO:0007417	0.461	central nervous system development
GO:0021987	0.441	cerebral cortex development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005576	0.992	extracellular region
GO:0005622	0.888	intracellular anatomical structure
GO:0016020	0.856	membrane
GO:0043226	0.848	organelle
GO:0043229	0.838	intracellular organelle
GO:0043227	0.834	membrane-bounded organelle
GO:0043231	0.821	intracellular membrane-bounded organelle
GO:0005737	0.813	cytoplasm
GO:0071944	0.812	cell periphery
GO:0070013	0.549	intracellular organelle lumen
GO:0005886	0.451	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]