StarFunc result for job id P0DTU3

User Input

>input (275 residues)
MACPGFLWALVISTCLEFSMAQTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQP
PSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRSAVNA
RLMFGDGTQLVVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITD
KTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFET
DTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DTU3	1.000	1.000	1.919E-52	275	1.000	1.000	P0DTU3.pdb.gz	TRAR2_HUMAN T cell receptor alpha chain MC.7.G5 OS=Homo sapiens OX=9606 GN=TRA PE=1 SV=1
2	AFDB:P0DSE1	0.611	0.623	8.481E-36	268	0.662	0.679	P0DSE1.pdb.gz	TRAR1_HUMAN M1-specific T cell receptor alpha chain OS=Homo sapiens OX=9606 GN=TRA PE=1 SV=1
3	PDB:6jxrm	0.859	0.950	7.961E-33	248	0.655	0.726	6jxrm.pdb.gz
4	PDB:5hhmI	0.669	0.928	3.268E-25	196	0.451	0.633	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
5	PDB:1bd2D	0.612	0.857	1.143E-24	190	0.451	0.653	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
6	AFDB:Q8N355	0.348	0.403	7.703E-13	234	0.185	0.218	Q8N355.pdb.gz	Q8N355_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
7	AFDB:Q6PIQ7	0.339	0.390	5.179E-12	236	0.189	0.220	Q6PIQ7.pdb.gz	Q6PIQ7_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
8	PDB:1q0xL	0.381	0.459	6.697E-12	212	0.167	0.217	1q0xL.pdb.gz
9	PDB:1jnhA	0.399	0.496	7.885E-12	208	0.160	0.212	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
10	PDB:3c2aL	0.329	0.411	8.326E-12	216	0.204	0.259	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
11	PDB:1mh5L	0.393	0.483	9.803E-12	212	0.149	0.193	1mh5L.pdb.gz	High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
12	PDB:1cf8L	0.380	0.459	1.784E-11	215	0.167	0.214	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
13	AFDB:A0A0A6YYK7	0.361	0.831	2.020E-11	116	0.193	0.457	A0A0A6YYK7.pdb.gz	TVA19_HUMAN T cell receptor alpha variable 19 OS=Homo sapiens OX=9606 GN=TRAV19 PE=2 SV=5
14	PDB:1aqkL	0.401	0.483	3.075E-11	216	0.171	0.218	1aqkL.pdb.gz
15	PDB:5c7kF	0.385	0.469	4.263E-11	212	0.145	0.189	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
16	AFDB:P0DSE2	0.351	0.318	4.826E-11	310	0.193	0.171	P0DSE2.pdb.gz	TRBR1_HUMAN M1-specific T cell receptor beta chain OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
17	AFDB:A4JYS5	0.366	0.341	1.286E-10	298	0.182	0.168	A4JYS5.pdb.gz	A4JYS5_DANRE Uncharacterized protein LOC792578 OS=Danio rerio OX=7955 GN=zgc:165604 PE=1 SV=1
18	AFDB:P0DOX3	0.356	0.225	2.216E-10	512	0.160	0.086	P0DOX3.pdb.gz	IGD_HUMAN Immunoglobulin delta heavy chain OS=Homo sapiens OX=9606 PE=1 SV=1
19	AFDB:P0DTU4	0.332	0.294	4.034E-10	315	0.167	0.146	P0DTU4.pdb.gz	TRBR2_HUMAN T cell receptor beta chain MC.7.G5 OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
20	AFDB:D4AE25	0.364	0.349	4.260E-10	290	0.164	0.155	D4AE25.pdb.gz	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DTU3	0.0	566	275	1.000	1.000	TRAR2_HUMAN T cell receptor alpha chain MC.7.G5 OS=Homo sapiens OX=9606 GN=TRA PE=1 SV=1
2	P0DSE1	6.51e-118	340	268	0.651	0.668	TRAR1_HUMAN M1-specific T cell receptor alpha chain OS=Homo sapiens OX=9606 GN=TRA PE=1 SV=1
3	P01848	1.97e-97	283	140	0.509	1.000	TRAC_HUMAN T cell receptor alpha chain constant OS=Homo sapiens OX=9606 GN=TRAC PE=1 SV=2
4	A0A0A6YYK7	2.90e-34	122	116	0.204	0.483	TVA19_HUMAN T cell receptor alpha variable 19 OS=Homo sapiens OX=9606 GN=TRAV19 PE=2 SV=5
5	P04437	1.10e-15	73.6	119	0.145	0.336	TVA29_HUMAN T cell receptor alpha variable 29/delta variable 5 OS=Homo sapiens OX=9606 GN=TRAV29DV5 PE=1 SV=2
6	P01737	1.01e-11	62.8	113	0.127	0.310	TVA84_HUMAN T cell receptor alpha variable 8-4 OS=Homo sapiens OX=9606 GN=TRAV8-4 PE=2 SV=2
7	Q6PIK1	3.77e-10	60.8	235	0.175	0.204	Q6PIK1_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
8	Q6PIQ7	8.68e-09	57.0	236	0.167	0.195	Q6PIQ7_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
9	P0DSE2	1.85e-08	56.6	310	0.153	0.135	TRBR1_HUMAN M1-specific T cell receptor beta chain OS=Homo sapiens OX=9606 GN=TRB PE=1 SV=1
10	P01701	3.43e-08	53.1	117	0.135	0.316	LV151_HUMAN Immunoglobulin lambda variable 1-51 OS=Homo sapiens OX=9606 GN=IGLV1-51 PE=1 SV=2
11	Q8N355	6.21e-08	54.3	234	0.160	0.188	Q8N355_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
12	P06331	3.02e-07	50.4	123	0.109	0.244	HV434_HUMAN Immunoglobulin heavy variable 4-34 OS=Homo sapiens OX=9606 GN=IGHV4-34 PE=1 SV=2
13	P01715	3.41e-07	50.1	115	0.116	0.278	LV301_HUMAN Immunoglobulin lambda variable 3-1 OS=Homo sapiens OX=9606 GN=IGLV3-1 PE=1 SV=2
14	P04211	6.41e-07	49.3	117	0.124	0.291	LV743_HUMAN Immunoglobulin lambda variable 7-43 OS=Homo sapiens OX=9606 GN=IGLV7-43 PE=3 SV=2
15	P01709	6.48e-07	49.3	118	0.124	0.288	LV208_HUMAN Immunoglobulin lambda variable 2-8 OS=Homo sapiens OX=9606 GN=IGLV2-8 PE=1 SV=2
16	P01825	6.53e-07	49.3	116	0.113	0.267	HV459_HUMAN Immunoglobulin heavy variable 4-59 OS=Homo sapiens OX=9606 GN=IGHV4-59 PE=1 SV=2
17	A4JYR2	7.65e-07	50.1	161	0.145	0.248	A4JYR2_DANRE Novel immune-type receptor 14b OS=Danio rerio OX=7955 GN=si:dkey-149k8.5 PE=1 SV=1
18	P01714	1.02e-06	48.5	112	0.124	0.304	LV319_HUMAN Immunoglobulin lambda variable 3-19 OS=Homo sapiens OX=9606 GN=IGLV3-19 PE=1 SV=2
19	Q5NV65	1.55e-06	47.8	99	0.113	0.313	Q5NV65_HUMAN V1-5 protein (Fragment) OS=Homo sapiens OX=9606 GN=V1-5 PE=4 SV=1
20	Q6SJQ5	1.75e-06	50.4	245	0.131	0.147	CLM3_MOUSE CMRF35-like molecule 3 OS=Mus musculus OX=10090 GN=Cd300ld3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09291 DUF1968	2.5e-34	128.4	Domain of unknown function (DUF1968)
2	PF07679 I-set	25	16.3	Immunoglobulin I-set domain
3	PF00047 ig	23	16.6	Immunoglobulin domain
4	PF13895 Ig_2	6.6	18.4	Immunoglobulin domain
5	PF13927 Ig_3	0.022	26.6	Immunoglobulin domain
6	PF07686 V-set	1e-16	72.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017799

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004798	0.792	IL2-inducible T-cell kinase
2	61853.ENSNLEP00000008977	0.792	CD3e molecule, epsilon (CD3-TCR complex)
3	61853.ENSNLEP00000006260	0.776	CD2 molecule
4	61853.ENSNLEP00000009456	0.621	Programmed cell death 1
5	61853.ENSNLEP00000021949	0.584	Protein tyrosine phosphatase, receptor type, C
6	61853.ENSNLEP00000010990	0.580	CD274 molecule
7	61853.ENSNLEP00000011009	0.564	Programmed cell death 1 ligand 2
8	61853.ENSNLEP00000005523	0.563	Protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
9	61853.ENSNLEP00000007672	0.559	tRNA-splicing endonuclease subunit Sen34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0060089	0.999	molecular transducer activity
GO:0005515	0.993	protein binding
GO:0038023	0.987	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009607	0.994	response to biotic stimulus
GO:0002250	0.987	adaptive immune response
GO:0002252	0.983	immune effector process
GO:0009987	0.925	cellular process
GO:0001906	0.838	cell killing
GO:0002449	0.836	lymphocyte mediated immunity
GO:0002460	0.836	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002456	0.815	T cell mediated immunity
GO:0051606	0.781	detection of stimulus
GO:0001909	0.663	leukocyte mediated cytotoxicity
GO:0009595	0.603	detection of biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098796	0.986	membrane protein complex
GO:0098802	0.984	plasma membrane signaling receptor complex
GO:0042101	0.925	T cell receptor complex
GO:0042105	0.726	alpha-beta T cell receptor complex
GO:0009986	0.713	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]