StarFunc result for job id P0DUD3

User Input

>input (265 residues)
MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKR
KRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPV
IKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQ
NIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVS
LEELEEIQAYDPEHWVWARDRAHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DTA3	0.674	0.674	1.966E-32	265	0.996	0.996	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
2	AFDB:P0CI01	0.576	0.387	5.225E-26	402	0.849	0.560	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
3	AFDB:A6NLX3	0.573	0.638	3.306E-19	237	0.619	0.692	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
4	AFDB:Q5IBH6	0.628	0.621	8.846E-17	268	0.494	0.489	Q5IBH6.pdb.gz	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
5	AFDB:Q9YGL1	0.506	0.452	2.013E-11	298	0.291	0.258	Q9YGL1.pdb.gz	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
6	AFDB:Q9PU13	0.493	0.438	8.143E-11	299	0.302	0.268	Q9PU13.pdb.gz	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	AFDB:Q5MJ68	0.495	0.450	5.596E-10	293	0.257	0.232	Q5MJ68.pdb.gz	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
8	AFDB:A0A384MTT5	0.492	0.419	3.328E-9	313	0.245	0.208	A0A384MTT5.pdb.gz	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
9	AFDB:Q5IBH7	0.492	0.424	3.204E-8	310	0.242	0.206	Q5IBH7.pdb.gz	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	AFDB:O64624	0.136	0.060	3.938E-2	822	0.189	0.061	O64624.pdb.gz	PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g18940 PE=2 SV=1
11	PDB:7kpvB	0.158	0.147	1.148	290	0.136	0.124	7kpvB.pdb.gz
12	PDB:3aouA	0.114	0.171	1.327	156	0.072	0.122	3aouA.pdb.gz	Structure of the rotor ring modified with N,N'-dicyclohexylcarbodiimide of the Na+-transporting vacuolar ATPase.
13	PDB:5veuL	0.159	0.108	1.859	448	0.091	0.054	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
14	PDB:4cniC	0.115	0.154	1.951	171	0.075	0.117	4cniC.pdb.gz
15	PDB:4l1jB	0.132	0.150	1.951	195	0.075	0.103	4l1jB.pdb.gz
16	PDB:3dzyA	0.165	0.151	2.149	302	0.094	0.083	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
17	PDB:7ou2B	0.120	0.065	2.149	650	0.143	0.058	7ou2B.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
18	PDB:5h9tH	0.096	0.117	2.734	199	0.091	0.121	5h9tH.pdb.gz
19	PDB:2w8qA	0.100	0.061	2.869	485	0.072	0.039	2w8qA.pdb.gz	Redox-Switch Modulation of Human Ssadh by Dynamic Catalytic Loop.
20	PDB:1lw1A	0.125	0.146	3.011	175	0.113	0.171	1lw1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DTA3	0.0	544	265	0.996	0.996	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
2	P0CI01	6.27e-115	337	402	0.698	0.460	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
3	Q495Y8	1.07e-114	337	402	0.698	0.460	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
4	A6NLX3	1.96e-98	289	237	0.634	0.709	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	8.55e-78	238	268	0.513	0.507	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9YGL1	3.62e-23	97.8	298	0.260	0.232	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
7	Q9PU13	4.47e-23	97.4	299	0.245	0.217	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
8	Q5MJ68	5.24e-23	97.4	293	0.230	0.208	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q5IBH7	2.06e-14	73.9	310	0.230	0.197	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
10	A0A384MTT5	1.91e-13	71.2	313	0.200	0.169	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
11	Q5MJ70	1.91e-13	71.2	313	0.200	0.169	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
12	Q4R1K5	3.59e-13	70.1	311	0.200	0.170	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
13	Q1DBP2	0.61	33.9	388	0.064	0.044	Q1DBP2_MYXXD Sensor histidine kinase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=MXAN_1679 PE=1 SV=1
14	Q961D9	0.70	33.9	1469	0.072	0.013	BCL9_DROME Protein BCL9 homolog OS=Drosophila melanogaster OX=7227 GN=lgs PE=1 SV=1
15	A0A2U3U043	2.4	32.0	865	0.102	0.031	A0A2U3U043_HUMAN Potassium channel tetramerization domain containing 1 OS=Homo sapiens OX=9606 GN=KCTD1 PE=1 SV=1
16	E7F366	2.9	32.0	2899	0.064	0.006	E7F366_DANRE Bromodomain PHD finger transcription factor OS=Danio rerio OX=7955 GN=bptf PE=1 SV=4
17	O74630	6.6	30.8	2812	0.060	0.006	ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tel1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	9e-48	173.3	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000019628

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002808	0.808	Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset
2	9601.ENSPPYP00000005283	0.800	Cyclin-dependent kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0099602	0.991	neurotransmitter receptor regulator activity
GO:0030548	0.888	acetylcholine receptor regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051726	0.963	regulation of cell cycle
GO:0045859	0.940	regulation of protein kinase activity
GO:0000079	0.931	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0048522	0.849	positive regulation of cellular process
GO:0045787	0.567	positive regulation of cell cycle
GO:0031325	0.481	positive regulation of cellular metabolic process
GO:0051173	0.456	positive regulation of nitrogen compound metabolic process
GO:0010604	0.448	positive regulation of macromolecule metabolic process
GO:0009987	0.343	cellular process
GO:0045737	0.326	positive regulation of cyclin-dependent protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.988	cytoplasm
GO:0005634	0.988	nucleus
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0043233	0.933	organelle lumen
GO:0031981	0.847	nuclear lumen
GO:0005654	0.755	nucleoplasm
GO:0012505	0.456	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]