StarFunc result for job id P10070

User Input

>input (1586 residues)
METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHA
PLPIDMRHQEGRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHP
YVNPHMEHYLRSVHSSPTLSMISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQM
TLVAGHPAPYGDLLMQSGGAASAPHLHDYLNPVDVSRFSSPRVTPRLSRKRALSISPLSD
ASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQIL
SQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSDTNQNKQSSES
AVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED
LDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTRE
QKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGC
NKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQR
NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGA
QSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLR
KHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPA
GLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP
LGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGP
PPTPLPGLERMSLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHE
APGGGARRASDPVRRPDALSLPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLA
RGAYSPRPPSISENVAMEAVAAGVDGAGPEADLGLPEDDLVLPDDVVQYIKAHASGALDE
GTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPSAPMLGGCQLGFGAPSSLNKN
NMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQGLQASPGGLDS
TQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS
GALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQS
YPQQSHHLAASMSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPT
GRHRGVRAVQQQLAYARATGHAMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAP
DHSMLYYYGQIHMYEQDGGLENLGSCQVMRSQPPQPQACQDSIQPQPLPSPGVNQVSSTV
DSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQNSSRLTTPRNSLTLPSIPAGI
SNMAVGDMSSMLTSLAEESKFLNMMT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QMX9	0.162	0.175	0.000	1443	0.544	0.598	A0A2R8QMX9.pdb.gz
2	AFDB:F1M2B7	0.169	0.172	0.000	1544	0.817	0.839	F1M2B7.pdb.gz	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
3	AFDB:P10070	0.999	0.999	0.000	1586	1.000	1.000	P10070.pdb.gz	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
4	AFDB:P10071	0.220	0.220	1.176E-93	1580	0.463	0.465	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
5	AFDB:Q61602	0.218	0.218	4.227E-93	1583	0.460	0.461	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
6	AFDB:F1QH64	0.130	0.158	7.530E-90	1225	0.461	0.597	F1QH64.pdb.gz
7	AFDB:Q9IA31	0.156	0.160	1.107E-87	1544	0.456	0.468	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
8	AFDB:F1QSH8	0.190	0.194	2.723E-78	1553	0.403	0.411	F1QSH8.pdb.gz
9	AFDB:F1QAC4	0.137	0.152	4.019E-68	1404	0.351	0.396	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
10	AFDB:P08151	0.107	0.152	4.917E-50	1106	0.277	0.398	P08151.pdb.gz	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
11	PDB:4rwnA	0.023	0.066	4.955	349	0.013	0.057	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
12	PDB:7qhsG	0.023	0.040	4.955	756	0.014	0.029	7qhsG.pdb.gz	Mechanism of replication origin melting nucleated by CMG helicase assembly.
13	PDB:1e6bA	0.024	0.111	5.632	194	0.009	0.077	1e6bA.pdb.gz
14	PDB:7oniH	0.026	0.067	5.632	380	0.012	0.050	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
15	PDB:7od1A	0.029	0.063	7.754	430	0.012	0.044	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:7ctfA	0.016	0.191	8.266	102	0.006	0.098	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
17	PDB:3fsyD	0.015	0.068	9.395	308	0.003	0.016	3fsyD.pdb.gz	The three-dimensional Structure of a mycobacterial DapD provides insights into DapD diversity and reveals unexpected particulars about the enzymatic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YGX0	0.0	984	1521	0.390	0.407	A0A2R8YGX0_HUMAN GLI family zinc finger 3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=1
2	A0A8I6AWR3	0.0	2383	1477	0.784	0.842	A0A8I6AWR3_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=1
3	F1M2B7	0.0	2463	1544	0.815	0.837	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
4	F1M9H1	0.0	976	1582	0.390	0.391	F1M9H1_RAT GLI family zinc finger 3 OS=Rattus norvegicus OX=10116 GN=Gli3 PE=3 SV=3
5	F1QAC4	0.0	656	1404	0.289	0.327	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
6	P10070	0.0	3221	1586	1.000	1.000	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
7	P10071	0.0	986	1580	0.390	0.392	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
8	Q0VGT2	0.0	2465	1544	0.824	0.847	GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus OX=10090 GN=Gli2 PE=1 SV=2
9	Q0VGV1	0.0	2449	1540	0.820	0.844	Q0VGV1_MOUSE Gli2 protein OS=Mus musculus OX=10090 GN=Gli2 PE=2 SV=1
10	Q5BN24	0.0	1157	1363	0.437	0.508	Q5BN24_DANRE GLI family zinc finger 2b OS=Danio rerio OX=7955 GN=gli2b PE=2 SV=2
11	Q61602	0.0	971	1583	0.383	0.383	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
12	Q6U6Z9	0.0	788	1553	0.342	0.350	Q6U6Z9_DANRE Transcriptional activator GLI3 OS=Danio rerio OX=7955 GN=im:7142603 PE=2 SV=1
13	Q800Z9	0.0	657	1404	0.289	0.327	Q800Z9_DANRE Zinc finger transcription factor detour OS=Danio rerio OX=7955 GN=gli1 PE=2 SV=1
14	Q8K0K3	0.0	745	538	0.255	0.751	Q8K0K3_MOUSE Gli2 protein (Fragment) OS=Mus musculus OX=10090 GN=Gli2 PE=1 SV=1
15	Q9IA31	0.0	1045	1544	0.392	0.403	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
16	Q9YGS4	0.0	1451	1439	0.554	0.611	Q9YGS4_DANRE Zinc finger protein GLI2 OS=Danio rerio OX=7955 GN=you-too PE=2 SV=2
17	P55878	6.23e-154	483	556	0.183	0.522	GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus OX=9031 GN=GLI1 PE=2 SV=1
18	P08151	9.36e-153	498	1106	0.239	0.343	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
19	G3V6X8	2.19e-149	488	1109	0.234	0.335	G3V6X8_RAT GLI family zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Gli1 PE=3 SV=1
20	P47806	5.37e-148	485	1111	0.224	0.320	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	0.11	24.3	FOXP coiled-coil domain
2	PF00096 zf-C2H2	4.6e-13	60.0	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.014	27.1	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	2.8e-06	38.7	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000390436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358918	0.999	Suppressor of fused homolog
2	9606.ENSP00000297261	0.997	Sonic hedgehog protein
3	9606.ENSP00000377001	0.997	Speckle-type POZ protein
4	9606.ENSP00000249373	0.993	Smoothened homolog
5	9606.ENSP00000295709	0.992	Serine/threonine-protein kinase 36
6	9606.ENSP00000359206	0.988	F-box/WD repeat-containing protein 1A
7	9606.ENSP00000392025	0.988	Ubiquitin carboxyl-terminal hydrolase CYLD
8	9606.ENSP00000332353	0.976	Protein patched homolog 1
9	9606.ENSP00000376458	0.969	Cell adhesion molecule-related/down-regulated by oncogenes
10	9606.ENSP00000265097	0.967	THO complex subunit 3
11	9606.ENSP00000385808	0.967	Kinesin-like protein KIF3A
12	9606.ENSP00000377934	0.966	Kinesin-like protein KIF7
13	9606.ENSP00000323580	0.965	Intraflagellar transport protein 88 homolog
14	9606.ENSP00000326804	0.961	Cullin-1
15	9606.ENSP00000400312	0.956	Serine/threonine-protein kinase ULK3
16	9606.ENSP00000322804	0.955	Metastasis suppressor protein 1
17	9606.ENSP00000360493	0.955	Runt-related transcription factor 2
18	9606.ENSP00000342144	0.954	Limbin
19	9606.ENSP00000417610	0.952	Ras-related protein Rab-23
20	9606.ENSP00000260570	0.951	Intraflagellar transport protein 172 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0003690	0.999	double-stranded DNA binding
GO:1990837	0.994	sequence-specific double-stranded DNA binding
GO:0003682	0.987	chromatin binding
GO:1990841	0.934	promoter-specific chromatin binding
GO:0008270	0.890	zinc ion binding
GO:0000976	0.523	transcription cis-regulatory region binding
GO:0000987	0.363	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.356	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.301	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0009987	0.985	cellular process
GO:0050896	0.982	response to stimulus
GO:0007275	0.964	multicellular organism development
GO:0080090	0.947	regulation of primary metabolic process
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0048519	0.935	negative regulation of biological process
GO:0048731	0.929	system development
GO:0060255	0.928	regulation of macromolecule metabolic process
GO:0010468	0.919	regulation of gene expression
GO:0019219	0.897	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.887	cellular response to stimulus
GO:0048523	0.882	negative regulation of cellular process
GO:0051252	0.877	regulation of RNA metabolic process
GO:0048513	0.872	animal organ development
GO:0007154	0.867	cell communication
GO:0010604	0.851	positive regulation of macromolecule metabolic process
GO:0007165	0.816	signal transduction
GO:0048522	0.815	positive regulation of cellular process
GO:0009892	0.805	negative regulation of metabolic process
GO:0010605	0.760	negative regulation of macromolecule metabolic process
GO:0051172	0.753	negative regulation of nitrogen compound metabolic process
GO:0001655	0.743	urogenital system development
GO:0010556	0.725	regulation of macromolecule biosynthetic process
GO:0031326	0.724	regulation of cellular biosynthetic process
GO:0006355	0.706	regulation of DNA-templated transcription
GO:0051173	0.686	positive regulation of nitrogen compound metabolic process
GO:0031324	0.660	negative regulation of cellular metabolic process
GO:0031325	0.654	positive regulation of cellular metabolic process
GO:0007166	0.652	cell surface receptor signaling pathway
GO:0009653	0.600	anatomical structure morphogenesis
GO:0000003	0.575	reproduction
GO:0009605	0.529	response to external stimulus
GO:0006357	0.508	regulation of transcription by RNA polymerase II
GO:0045893	0.507	positive regulation of DNA-templated transcription
GO:0008152	0.404	metabolic process
GO:0022414	0.399	reproductive process
GO:0051253	0.389	negative regulation of RNA metabolic process
GO:0061458	0.375	reproductive system development
GO:0048732	0.371	gland development
GO:0071704	0.360	organic substance metabolic process
GO:0030154	0.358	cell differentiation
GO:0048583	0.349	regulation of response to stimulus
GO:0023051	0.314	regulation of signaling
GO:0010646	0.314	regulation of cell communication
GO:0045944	0.306	positive regulation of transcription by RNA polymerase II
GO:0009966	0.300	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0120025	0.992	plasma membrane bounded cell projection
GO:0005829	0.987	cytosol
GO:0005929	0.982	cilium
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0032991	0.931	protein-containing complex
GO:0097542	0.644	ciliary tip

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]