StarFunc result for job id P10071

User Input

>input (1580 residues)
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS
QSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL
ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL
GDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR
VPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTM
DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAG
QQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH
PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQ
GYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVV
RGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYS
GQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE
GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIG
DMSSLLTSLAEESKFLAVMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10071	0.999	0.999	0.000	1580	1.000	1.000	P10071.pdb.gz	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
2	AFDB:Q61602	0.267	0.267	0.000	1583	0.866	0.864	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
3	AFDB:Q9IA31	0.191	0.195	0.000	1544	0.763	0.780	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
4	AFDB:F1QSH8	0.193	0.196	1.882E-102	1553	0.516	0.525	F1QSH8.pdb.gz
5	AFDB:A0A2R8QMX9	0.152	0.164	4.369E-94	1443	0.454	0.497	A0A2R8QMX9.pdb.gz
6	AFDB:P10070	0.220	0.219	5.724E-93	1586	0.464	0.462	P10070.pdb.gz	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
7	AFDB:F1M2B7	0.159	0.162	3.668E-90	1544	0.458	0.469	F1M2B7.pdb.gz	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
8	AFDB:F1QH64	0.129	0.160	7.014E-79	1225	0.380	0.490	F1QH64.pdb.gz
9	AFDB:F1QAC4	0.137	0.151	4.478E-63	1404	0.335	0.377	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
10	AFDB:P47806	0.116	0.163	3.816E-45	1111	0.258	0.367	P47806.pdb.gz	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
11	PDB:4rwnA	0.027	0.081	4.092	349	0.013	0.057	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
12	PDB:6aagC	0.028	0.122	4.357	139	0.009	0.108	6aagC.pdb.gz
13	PDB:6vvvC	0.021	0.038	5.600	790	0.006	0.013	6vvvC.pdb.gz	The antibiotic sorangicin A inhibits promoter DNA unwinding in a Mycobacterium tuberculosis rifampicin-resistant RNA polymerase.
14	PDB:7ctfA	0.017	0.191	5.962	102	0.006	0.088	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
15	PDB:5tthB	0.023	0.053	6.349	621	0.004	0.011	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:5zx3C	0.020	0.027	6.760	1105	0.008	0.011	5zx3C.pdb.gz	Structural basis for transcription initiation by bacterial ECF sigma factors.
17	PDB:5ijnC	0.022	0.042	7.663	636	0.009	0.024	5ijnC.pdb.gz
18	PDB:6eydC	0.019	0.027	7.663	1092	0.008	0.011	6eydC.pdb.gz	The Core and Holoenzyme Forms of RNA Polymerase fromMycobacterium smegmatis.
19	PDB:7od1A	0.029	0.064	7.663	430	0.012	0.044	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
20	PDB:7oniH	0.027	0.075	7.663	380	0.009	0.037	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YGX0	0.0	3120	1521	0.963	1.000	A0A2R8YGX0_HUMAN GLI family zinc finger 3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=1
2	A0A8I6AWR3	0.0	1065	1477	0.457	0.489	A0A8I6AWR3_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=1
3	F1M2B7	0.0	1089	1544	0.463	0.473	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
4	F1M9H1	0.0	2689	1582	0.865	0.863	F1M9H1_RAT GLI family zinc finger 3 OS=Rattus norvegicus OX=10116 GN=Gli3 PE=3 SV=3
5	F1QAC4	0.0	635	1404	0.277	0.311	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
6	P10070	0.0	988	1586	0.390	0.388	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
7	P10071	0.0	3239	1580	1.000	1.000	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
8	Q0VGT2	0.0	1071	1544	0.466	0.477	GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus OX=10090 GN=Gli2 PE=1 SV=2
9	Q0VGV1	0.0	1070	1540	0.470	0.482	Q0VGV1_MOUSE Gli2 protein OS=Mus musculus OX=10090 GN=Gli2 PE=2 SV=1
10	Q5BN24	0.0	934	1363	0.366	0.424	Q5BN24_DANRE GLI family zinc finger 2b OS=Danio rerio OX=7955 GN=gli2b PE=2 SV=2
11	Q61602	0.0	2704	1583	0.866	0.865	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
12	Q6U6Z9	0.0	1178	1553	0.466	0.474	Q6U6Z9_DANRE Transcriptional activator GLI3 OS=Danio rerio OX=7955 GN=im:7142603 PE=2 SV=1
13	Q800Z9	0.0	637	1404	0.277	0.311	Q800Z9_DANRE Zinc finger transcription factor detour OS=Danio rerio OX=7955 GN=gli1 PE=2 SV=1
14	Q9IA31	0.0	2325	1544	0.766	0.784	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
15	Q9YGS4	0.0	1050	1439	0.382	0.420	Q9YGS4_DANRE Zinc finger protein GLI2 OS=Danio rerio OX=7955 GN=you-too PE=2 SV=2
16	P55878	5.38e-154	483	556	0.172	0.487	GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus OX=9031 GN=GLI1 PE=2 SV=1
17	P47806	8.28e-143	471	1111	0.248	0.353	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
18	P08151	1.59e-142	469	1106	0.232	0.332	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
19	G3V6X8	2.92e-142	469	1109	0.231	0.329	G3V6X8_RAT GLI family zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Gli1 PE=3 SV=1
20	P19538	7.46e-89	321	1397	0.089	0.100	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	0.001	30.8	FOXP coiled-coil domain
2	PF00096 zf-C2H2	6.4e-16	69.0	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.0078	28.0	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	3.4e-08	44.7	Zinc-finger double domain
5	PF18366 zf_ZIC	9.7e+02	11.3	Zic proteins zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358918	0.999	Suppressor of fused homolog
2	9606.ENSP00000377001	0.998	Speckle-type POZ protein
3	9606.ENSP00000332353	0.994	Protein patched homolog 1
4	9606.ENSP00000359206	0.994	F-box/WD repeat-containing protein 1A
5	9606.ENSP00000249373	0.992	Smoothened homolog
6	9606.ENSP00000277541	0.989	Neurogenic locus notch homolog protein 1
7	9606.ENSP00000345206	0.988	Recombining binding protein suppressor of hairless
8	9606.ENSP00000262367	0.975	CREB-binding protein
9	9606.ENSP00000265094	0.970	F-box/WD repeat-containing protein 11
10	9606.ENSP00000385808	0.969	Kinesin-like protein KIF3A
11	9606.ENSP00000362649	0.967	Histone deacetylase 1
12	9606.ENSP00000323580	0.963	Intraflagellar transport protein 88 homolog
13	9606.ENSP00000295709	0.962	Serine/threonine-protein kinase 36
14	9606.ENSP00000377934	0.962	Kinesin-like protein KIF7
15	9606.ENSP00000417610	0.962	Ras-related protein Rab-23
16	9606.ENSP00000326804	0.957	Cullin-1
17	9606.ENSP00000421689	0.955	Casein kinase I isoform alpha
18	9606.ENSP00000260570	0.954	Intraflagellar transport protein 172 homolog
19	9606.ENSP00000280098	0.953	Speckle-type POZ protein-like
20	9606.ENSP00000400312	0.952	Serine/threonine-protein kinase ULK3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:0003690	0.979	double-stranded DNA binding
GO:0000978	0.974	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019899	0.900	enzyme binding
GO:0035035	0.511	histone acetyltransferase binding
GO:0036033	0.510	mediator complex binding
GO:0042826	0.498	histone deacetylase binding
GO:0008013	0.479	beta-catenin binding
GO:0000981	0.314	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0032502	0.981	developmental process
GO:0032501	0.981	multicellular organismal process
GO:0019222	0.976	regulation of metabolic process
GO:0050896	0.970	response to stimulus
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0048856	0.962	anatomical structure development
GO:0048519	0.959	negative regulation of biological process
GO:0010468	0.959	regulation of gene expression
GO:0007275	0.946	multicellular organism development
GO:0007165	0.946	signal transduction
GO:0048518	0.943	positive regulation of biological process
GO:0048523	0.938	negative regulation of cellular process
GO:0051252	0.935	regulation of RNA metabolic process
GO:0006355	0.896	regulation of DNA-templated transcription
GO:0009893	0.884	positive regulation of metabolic process
GO:0051172	0.882	negative regulation of nitrogen compound metabolic process
GO:0010605	0.882	negative regulation of macromolecule metabolic process
GO:0006357	0.873	regulation of transcription by RNA polymerase II
GO:0007166	0.870	cell surface receptor signaling pathway
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0048731	0.866	system development
GO:0031324	0.866	negative regulation of cellular metabolic process
GO:0048513	0.865	animal organ development
GO:0045934	0.851	negative regulation of nucleobase-containing compound metabolic process
GO:0048522	0.850	positive regulation of cellular process
GO:0051253	0.842	negative regulation of RNA metabolic process
GO:0010558	0.840	negative regulation of macromolecule biosynthetic process
GO:0031327	0.840	negative regulation of cellular biosynthetic process
GO:0048732	0.829	gland development
GO:0045892	0.829	negative regulation of DNA-templated transcription
GO:0007224	0.804	smoothened signaling pathway
GO:0045595	0.788	regulation of cell differentiation
GO:0060284	0.760	regulation of cell development
GO:0051239	0.751	regulation of multicellular organismal process
GO:0051173	0.703	positive regulation of nitrogen compound metabolic process
GO:0048869	0.697	cellular developmental process
GO:0031325	0.681	positive regulation of cellular metabolic process
GO:0045935	0.648	positive regulation of nucleobase-containing compound metabolic process
GO:0048583	0.641	regulation of response to stimulus
GO:0031328	0.609	positive regulation of cellular biosynthetic process
GO:0010557	0.608	positive regulation of macromolecule biosynthetic process
GO:0051254	0.605	positive regulation of RNA metabolic process
GO:2000026	0.533	regulation of multicellular organismal development
GO:0009653	0.529	anatomical structure morphogenesis
GO:1902680	0.525	positive regulation of RNA biosynthetic process
GO:0045893	0.524	positive regulation of DNA-templated transcription
GO:0030154	0.519	cell differentiation
GO:0060173	0.509	limb development
GO:0009966	0.468	regulation of signal transduction
GO:0065009	0.461	regulation of molecular function
GO:0000122	0.456	negative regulation of transcription by RNA polymerase II
GO:0071840	0.435	cellular component organization or biogenesis
GO:0045944	0.430	positive regulation of transcription by RNA polymerase II
GO:0008152	0.417	metabolic process
GO:0071704	0.409	organic substance metabolic process
GO:0016043	0.377	cellular component organization
GO:0009790	0.335	embryo development
GO:0043170	0.316	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005737	0.989	cytoplasm
GO:0032991	0.973	protein-containing complex
GO:0005829	0.954	cytosol
GO:0042995	0.858	cell projection
GO:0120025	0.853	plasma membrane bounded cell projection
GO:0005929	0.748	cilium
GO:0005730	0.637	nucleolus
GO:1990788	0.387	GLI-SUFU complex
GO:0097542	0.362	ciliary tip
GO:0097546	0.335	ciliary base

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]