StarFunc result for job id P10072

User Input

>input (659 residues)
MRVNHTVSTMLPTCMVHRQTMSCSGAGGITAFVAFRDVAVYFTQEEWRLLSPAQRTLHRE
VMLETYNHLVSLEIPSSKPKLIAQLERGEAPWREERKCPLDLCPESKPEIQLSPSCPLIF
SSQQALSQHVWLSHLSQLFSSLWAGNPLHLGKHYPEDQKQQQDPFCFSGKAEWIQEGEDS
RLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVS
GFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIKNPRTHSGGKP
YVCRECGRGFTWKSNLITHQRTHSGEKPYVCKDCGRGFTWKSNLFTHQRTHSGLKPYVCK
ECGQSFSLKSNLITHQRAHTGEKPYVCRECGRGFRQHSHLVRHKRTHSGEKPYICRECEQ
GFSQKSHLIRHLRTHTGEKPYVCTECGRHFSWKSNLKTHQRTHSGVKPYVCLECGQCFSL
KSNLNKHQRSHTGEKPFVCTECGRGFTRKSTLSTHQRTHSGEKPFVCAECGRGFNDKSTL
ISHQRTHSGEKPFMCRECGRRFRQKPNLFRHKRAHSGAFVCRECGQGFCAKLTLIKHQRA
HAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQRTHSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52736	0.437	0.439	1.658E-59	654	0.525	0.529	P52736.pdb.gz	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
2	AFDB:Q06732	0.435	0.377	6.188E-55	778	0.404	0.342	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	AFDB:Q02386	0.441	0.428	3.745E-51	682	0.401	0.387	Q02386.pdb.gz	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
4	AFDB:Q9UJW7	0.274	0.226	4.419E-51	825	0.384	0.307	Q9UJW7.pdb.gz	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
5	AFDB:Q9UJW8	0.373	0.356	5.057E-49	692	0.354	0.337	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
6	AFDB:Q9P0L1	0.406	0.361	2.239E-48	754	0.361	0.316	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
7	AFDB:O60765	0.268	0.288	2.792E-48	605	0.357	0.388	O60765.pdb.gz	Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens OX=9606 GN=ZNF354A PE=1 SV=2
8	AFDB:P17031	0.409	0.492	1.170E-47	533	0.349	0.432	P17031.pdb.gz	ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens OX=9606 GN=ZNF26 PE=1 SV=3
9	AFDB:Q6ZNH5	0.409	0.517	2.826E-47	498	0.317	0.420	Q6ZNH5.pdb.gz	ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens OX=9606 GN=ZNF497 PE=1 SV=2
10	AFDB:P17021	0.448	0.447	4.641E-47	662	0.378	0.376	P17021.pdb.gz	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
11	PDB:3w5kB	0.078	0.279	2.201E-4	110	0.065	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.048	0.109	8.574E-1	208	0.050	0.159	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6ff4t	0.043	0.111	1.408	172	0.041	0.157	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:8ap8d	0.061	0.120	1.661	270	0.056	0.137	8ap8d.pdb.gz
15	PDB:7od1A	0.061	0.083	1.960	430	0.050	0.077	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:5c8dE	0.073	0.124	2.443	280	0.044	0.104	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
17	PDB:5gm6a	0.033	0.131	2.582	123	0.036	0.195	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7ad8D	0.045	0.084	2.728	280	0.032	0.075	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
19	PDB:7fikP	0.062	0.066	2.728	593	0.035	0.039	7fikP.pdb.gz
20	PDB:6f40P	0.060	0.109	3.046	246	0.044	0.118	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94892	0.0	539	652	0.437	0.442	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
2	P52736	0.0	674	654	0.537	0.541	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
3	Q14929	0.0	580	603	0.487	0.532	ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens OX=9606 GN=ZNF169 PE=1 SV=3
4	Q6P1L6	0.0	544	599	0.476	0.524	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
5	Q9NQV7	0.0	569	894	0.458	0.338	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
6	Q9Y3M9	0.0	578	751	0.480	0.421	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
7	Q8N184	2.80e-170	503	647	0.434	0.442	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
8	P51523	3.39e-166	495	738	0.422	0.377	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	P52742	1.66e-160	478	658	0.416	0.416	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
10	Q8TAQ5	2.63e-159	476	688	0.428	0.410	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
11	Q96EQ9	2.09e-157	476	843	0.343	0.268	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
12	Q14587	2.51e-156	476	947	0.422	0.294	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
13	O75290	1.36e-153	460	641	0.387	0.398	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
14	P51814	7.96e-153	464	821	0.411	0.330	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
15	Q9P2J8	1.10e-152	464	865	0.410	0.312	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
16	P35789	1.34e-151	454	620	0.382	0.406	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
17	P17014	4.68e-151	455	697	0.437	0.413	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
18	Q96RE9	1.38e-149	448	604	0.392	0.427	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
19	Q9HCX3	1.28e-148	447	659	0.379	0.379	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
20	Q06732	7.06e-148	449	778	0.408	0.346	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11672 DUF3268	2.1e-05	36.1	zinc-finger-containing domain
2	PF12833 HTH_18	6.1	18.5	Helix-turn-helix domain
3	PF01352 KRAB	1.9e-19	80.3	KRAB box
4	PF00900 Ribosomal_S4e	20	16.4	Ribosomal family S4e
5	PF00096 zf-C2H2	8.3e-69	235.5	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	4e-09	47.4	zinc-finger C2H2-type
7	PF18868 zf-C2H2_3rep	0.3	23.2	Zinc finger C2H2-type, 3 repeats
8	PF13894 zf-C2H2_4	1.1e-42	152.0	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	0.0032	28.7	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	1.4e-05	36.5	Zinc-finger double-stranded RNA-binding
11	PF13465 zf-H2C2_2	2.3e-62	216.0	Zinc-finger double domain
12	PF13909 zf-H2C2_5	1.2e+02	13.8	C2H2-type zinc-finger domain
13	PF13451 zf-trcl	3.2e-05	35.0	Probable zinc-ribbon domain
14	PF02148 zf-UBP	1.8e+02	13.9	Zn-finger in ubiquitin-hydrolases and other protein
15	PF17032 zinc_ribbon_15	0.002	30.2	zinc-ribbon family
16	PF09723 Zn-ribbon_8	6.6e-07	40.7	Zinc ribbon domain
17	PF17283 Zn_ribbon_SprT	2e-05	35.8	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315505

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378548	0.511	Probable G-protein coupled receptor 135
2	9606.ENSP00000358548	0.510	GTPase NRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:1901363	0.811	heterocyclic compound binding
GO:0097159	0.811	organic cyclic compound binding
GO:1990837	0.403	sequence-specific double-stranded DNA binding
GO:0003700	0.315	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0006355	0.950	regulation of DNA-templated transcription
GO:0048519	0.949	negative regulation of biological process
GO:0010605	0.890	negative regulation of macromolecule metabolic process
GO:0048523	0.835	negative regulation of cellular process
GO:0009987	0.625	cellular process
GO:0051172	0.537	negative regulation of nitrogen compound metabolic process
GO:0045892	0.467	negative regulation of DNA-templated transcription
GO:0048518	0.377	positive regulation of biological process
GO:0048522	0.369	positive regulation of cellular process
GO:0050896	0.358	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.985	intracellular organelle lumen
GO:0031981	0.983	nuclear lumen
GO:0005654	0.940	nucleoplasm
GO:0005737	0.799	cytoplasm
GO:0012505	0.424	endomembrane system
GO:0071944	0.388	cell periphery
GO:0005886	0.381	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]