StarFunc result for job id P10073

User Input

>input (491 residues)
MAIPKHSLSPVPWEEDSFLQVKVEEEEEASLSQGGESSHDHIAHSEAARLRFRHFRYEEA
SGPHEALAHLRALCCQWLQPEAHSKEQILELLVLEQFLGALPPEIQAWVGAQSPKSGEEA
AVLVEDLTQVLDKRGWDPGAEPTEASCKQSDLGESEPSNVTETLMGGVSLGPAFVKACEP
EGSSERSGLSGEIWTKSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQE
KPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKTPYACSE
CGKAFSRSTHLAQHQVVHTGAKPHECKECGKAFSRVTHLTQHQRIHTGEKPYKCGECGKT
FSRSTHLTQHQRVHTGERPYECDACGKAFSQSTHLTQHQRIHTGEKPYKCDACGRAFSDC
SALIRHLRIHSGEKPYQCKVCPKAFAQSSSLIEHQRIHTGEKPYKCSDCGKAFSRSSALM
VHLRIHITVLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10073	1.000	1.000	2.724E-78	491	1.000	1.000	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
2	AFDB:Q15776	0.409	0.351	1.895E-37	578	0.432	0.367	Q15776.pdb.gz	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
3	AFDB:O14978	0.232	0.172	3.631E-36	683	0.456	0.328	O14978.pdb.gz	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
4	AFDB:Q3ZBY5	0.372	0.391	2.698E-35	466	0.411	0.433	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
5	AFDB:Q53GI3	0.275	0.244	2.698E-35	561	0.393	0.344	Q53GI3.pdb.gz	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
6	AFDB:Q9Y5A6	0.359	0.371	2.241E-34	473	0.387	0.402	Q9Y5A6.pdb.gz	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
7	AFDB:P17029	0.340	0.297	1.009E-33	563	0.403	0.352	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
8	AFDB:Q07231	0.363	0.326	1.066E-33	555	0.383	0.339	Q07231.pdb.gz	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
9	AFDB:Q6P9G9	0.324	0.310	6.705E-33	518	0.342	0.324	Q6P9G9.pdb.gz	ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens OX=9606 GN=ZNF449 PE=1 SV=3
10	AFDB:P49910	0.275	0.278	7.359E-32	485	0.373	0.377	P49910.pdb.gz	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
11	PDB:6ydhA	0.040	0.220	1.137	62	0.035	0.274	6ydhA.pdb.gz
12	PDB:4cabA	0.071	0.069	1.344	507	0.043	0.041	4cabA.pdb.gz	Structure of the Mono-Functional Heme Catalase Dr1998 from Deinococcus Radiodurans
13	PDB:7k98A	0.073	0.094	1.984	343	0.049	0.070	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
14	PDB:7r24A	0.079	0.220	2.098	150	0.035	0.113	7r24A.pdb.gz
15	PDB:1e7dA	0.057	0.111	2.622	157	0.037	0.115	1e7dA.pdb.gz	Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage
16	PDB:6nr7A	0.091	0.045	2.772	1086	0.026	0.012	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
17	PDB:7uhyC	0.050	0.044	2.772	578	0.035	0.029	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:7wffh	0.086	0.203	2.772	145	0.026	0.090	7wffh.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
19	PDB:6sgaFb	0.058	0.150	2.931	129	0.033	0.124	6sgaFb.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
20	PDB:7ajtUO	0.072	0.072	4.094	493	0.037	0.037	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10073	0.0	1009	491	1.000	1.000	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
2	Q8NF99	4.85e-126	379	534	0.460	0.423	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
3	Q86W11	4.19e-117	355	494	0.428	0.425	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
4	Q9BRR0	1.81e-113	347	538	0.450	0.411	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
5	Q16670	1.95e-108	332	478	0.395	0.406	ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=2
6	A0A024RCN4	3.88e-108	331	479	0.391	0.401	A0A024RCN4_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1
7	O43309	8.27e-108	335	611	0.440	0.354	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
8	Q07231	3.09e-106	329	555	0.389	0.344	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
9	Q9Y5A6	1.76e-105	324	473	0.383	0.397	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
10	Q3ZBY5	3.60e-105	323	466	0.383	0.403	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
11	P49910	2.20e-100	311	485	0.401	0.406	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
12	Q53Z40	2.20e-100	311	485	0.401	0.406	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
13	Q53GI3	1.64e-99	312	561	0.413	0.362	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
14	Q9C0F3	4.19e-99	308	470	0.279	0.291	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
15	P17036	4.96e-98	304	446	0.328	0.361	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
16	Q86U76	5.80e-98	303	410	0.338	0.405	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
17	Q96LW9	1.08e-96	300	406	0.371	0.448	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
18	Q15937	1.14e-96	302	498	0.281	0.277	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
19	P52742	1.74e-96	307	658	0.293	0.219	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
20	Q9HBT8	1.85e-96	303	521	0.277	0.261	Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	1e+02	14.3	Rad4 beta-hairpin domain 1
2	PF07975 C1_4	4.2	19.0	TFIIH C1-like domain
3	PF02023 SCAN	1.6e-35	132.1	SCAN domain
4	PF01286 XPA_N	0.021	26.2	XPA protein N-terminal
5	PF02892 zf-BED	2.3e+02	13.2	BED zinc finger
6	PF00096 zf-C2H2	3e-46	164.5	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	0.0012	29.9	zinc-finger C2H2-type
8	PF13894 zf-C2H2_4	2e-26	101.3	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	8.3e-11	52.9	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	4.8e-15	66.6	Zinc-finger double-stranded RNA-binding
11	PF13465 zf-H2C2_2	5.2e-60	208.6	Zinc-finger double domain
12	PF12874 zf-met	0.0044	28.6	Zinc-finger of C2H2 type
13	PF18508 zf_C2H2_13	3.3e+02	12.3	Zinc finger domain
14	PF18439 zf_UBZ	0.22	22.5	Ubiquitin-Binding Zinc Finger
15	PF17032 zinc_ribbon_15	0.15	24.2	zinc-ribbon family
16	PF09723 Zn-ribbon_8	0.0015	29.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380057	0.871	Zinc finger and SCAN domain-containing protein 32
2	9606.ENSP00000294753	0.857	Zinc finger protein 496
3	9606.ENSP00000363103	0.743	SCAN domain-containing protein 1
4	9606.ENSP00000355053	0.689	Zinc finger and SCAN domain-containing protein 20
5	9606.ENSP00000259883	0.683	PiggyBac transposable element-derived protein 1
6	9606.ENSP00000445247	0.557	Proline-rich protein 19
7	9606.ENSP00000455659	0.557	Uncharacterized protein
8	9606.ENSP00000292450	0.512	Zinc finger and SCAN domain-containing protein 21
9	9606.ENSP00000358548	0.510	GTPase NRas
10	9606.ENSP00000269967	0.504	Coiled-coil domain containing 97

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043565	0.940	sequence-specific DNA binding
GO:0003690	0.935	double-stranded DNA binding
GO:1990837	0.934	sequence-specific double-stranded DNA binding
GO:0140110	0.740	transcription regulator activity
GO:0003700	0.645	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.998	regulation of DNA-templated transcription
GO:0048522	0.986	positive regulation of cellular process
GO:0010557	0.976	positive regulation of macromolecule biosynthetic process
GO:0051254	0.976	positive regulation of RNA metabolic process
GO:0031328	0.975	positive regulation of cellular biosynthetic process
GO:0045893	0.969	positive regulation of DNA-templated transcription
GO:0048519	0.867	negative regulation of biological process
GO:0048523	0.779	negative regulation of cellular process
GO:0009892	0.771	negative regulation of metabolic process
GO:0009987	0.762	cellular process
GO:0010605	0.744	negative regulation of macromolecule metabolic process
GO:0006357	0.729	regulation of transcription by RNA polymerase II
GO:0009890	0.673	negative regulation of biosynthetic process
GO:0045892	0.659	negative regulation of DNA-templated transcription
GO:0045944	0.356	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.955	nuclear lumen
GO:0005654	0.868	nucleoplasm
GO:0005737	0.344	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]