StarFunc result for job id P10074

User Input

>input (688 residues)
MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSG
GSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSV
GQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSP
AQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDD
GDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVECPTCHKKF
LSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFR
RRMELRVHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRT
ELQLHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPHVCEFCSHAFTQKANL
NMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHV
ASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIH
DRVENYNPRQRKLRNLIIEDEKMVVVALQPPAELEVGSAEVIVESLAQGGLASQLPGQRL
CAEESFTGPGVLEPSLIITAAVPEDCDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10074	1.000	1.000	0.000	688	1.000	1.000	P10074.pdb.gz	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
2	AFDB:Q13105	0.223	0.194	6.044E-39	803	0.288	0.247	Q13105.pdb.gz	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
3	AFDB:O95625	0.253	0.178	1.321E-36	1053	0.273	0.179	O95625.pdb.gz	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
4	AFDB:F1RAC1	0.293	0.189	2.048E-34	1146	0.304	0.182	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
5	AFDB:E7F500	0.267	0.238	3.732E-31	794	0.267	0.232	E7F500.pdb.gz
6	AFDB:A0A024R4T5	0.275	0.260	8.818E-31	734	0.251	0.236	A0A024R4T5.pdb.gz
7	AFDB:Q9NQZ8	0.240	0.322	8.818E-31	489	0.205	0.288	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
8	AFDB:Q9Y473	0.261	0.253	1.967E-30	711	0.231	0.224	Q9Y473.pdb.gz	ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens OX=9606 GN=ZNF175 PE=1 SV=1
9	AFDB:E9PYI1	0.278	0.285	3.295E-30	671	0.212	0.218	E9PYI1.pdb.gz	ZN568_MOUSE Zinc finger protein 568 OS=Mus musculus OX=10090 GN=Znf568 PE=1 SV=1
10	AFDB:A2AWF2	0.248	0.249	4.647E-30	685	0.215	0.216	A2AWF2.pdb.gz	A2AWF2_MOUSE Reduced expression 2 OS=Mus musculus OX=10090 GN=Rex2 PE=1 SV=1
11	PDB:6wcqC	0.133	0.635	1.460E-4	130	0.036	0.192	6wcqC.pdb.gz
12	PDB:3w5kB	0.078	0.287	3.450E-4	110	0.048	0.300	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:6sgaFS	0.108	0.253	6.058E-3	277	0.035	0.087	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
14	PDB:7mk2A	0.122	0.213	6.793E-3	354	0.033	0.065	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
15	PDB:2p1nD	0.105	0.509	3.192E-2	127	0.017	0.094	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
16	PDB:5vztA	0.116	0.504	4.015E-2	145	0.026	0.124	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
17	PDB:7phhA	0.100	0.169	8.458E-2	396	0.017	0.030	7phhA.pdb.gz
18	PDB:6gypD	0.097	0.384	1.263E-1	151	0.026	0.119	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
19	PDB:2a79B	0.100	0.243	1.417E-1	259	0.023	0.062	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
20	PDB:7f3fA	0.095	0.138	1.417E-1	460	0.026	0.039	7f3fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10074	0.0	1415	688	1.000	1.000	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
2	Q60821	2.94e-72	251	794	0.291	0.252	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
3	P17141	2.03e-65	228	594	0.182	0.210	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
4	Q9NPC7	4.67e-65	228	610	0.265	0.298	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
5	Q8N184	2.57e-64	227	647	0.186	0.198	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
6	Q9NQZ8	5.80e-64	222	489	0.174	0.245	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
7	Q5MCW4	1.09e-63	226	686	0.177	0.178	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
8	Q15937	1.04e-62	219	498	0.176	0.243	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
9	Q99MD8	5.11e-62	219	610	0.260	0.293	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
10	Q4VA13	5.71e-62	220	630	0.180	0.197	Q4VA13_MOUSE OTTMUSG00000011070 protein OS=Mus musculus OX=10090 GN=Zfp980 PE=2 SV=1
11	A2A9J5	7.11e-62	220	645	0.180	0.192	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
12	P51814	7.85e-62	223	821	0.170	0.143	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
13	Q9UEG4	9.48e-62	223	869	0.177	0.140	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
14	Q6ZN57	1.62e-61	214	461	0.172	0.256	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
15	Q9W747	1.86e-61	213	411	0.188	0.314	DRL_DANRE Zinc finger protein draculin OS=Danio rerio OX=7955 GN=drl PE=2 SV=2
16	Q6PCM4	2.08e-61	217	567	0.183	0.222	Q6PCM4_MOUSE Zinc finger protein 157 OS=Mus musculus OX=10090 GN=Zfp157 PE=2 SV=1
17	P51523	2.27e-61	220	738	0.185	0.172	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
18	A0A0A0MS50	3.93e-61	217	604	0.186	0.212	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
19	Q96RE9	3.93e-61	217	604	0.186	0.212	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
20	Q9P0L1	4.49e-61	220	754	0.174	0.159	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.1e-18	78.8	BTB/POZ domain
2	PF07085 DRTGG	6.3e+02	11.6	DRTGG domain
3	PF14944 TCRP1	6.1e+02	11.7	Tongue Cancer Chemotherapy Resistant Protein 1
4	PF00096 zf-C2H2	1.1e-31	118.6	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	0.19	22.8	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	1.1e-25	99.1	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	0.0066	27.7	C2H2-type zinc finger
8	PF15909 zf-C2H2_8	35	16.2	C2H2-type zinc ribbon
9	PF12171 zf-C2H2_jaz	0.34	22.5	Zinc-finger double-stranded RNA-binding
10	PF05605 zf-Di19	2.4e-05	35.8	Drought induced 19 protein (Di19), zinc-binding
11	PF13465 zf-H2C2_2	1.3e-51	182.1	Zinc-finger double domain
12	PF13909 zf-H2C2_5	13	16.9	C2H2-type zinc-finger domain
13	PF12874 zf-met	1.6	20.4	Zinc-finger of C2H2 type
14	PF17032 zinc_ribbon_15	8.4e+02	12.2	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366902

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366934	0.821	Polynucleotide 5'-hydroxyl-kinase NOL9
2	9606.ENSP00000276603	0.783	Telomeric repeat-binding factor 1
3	9606.ENSP00000263736	0.758	S1 RNA-binding domain-containing protein 1
4	9606.ENSP00000358576	0.747	5' exonuclease Apollo
5	9606.ENSP00000362170	0.747	Nuclear apoptosis-inducing factor 1
6	9606.ENSP00000420405	0.746	Fibrinogen silencer-binding protein
7	9606.ENSP00000333275	0.705	Nuclear receptor subfamily 2 group C member 1
8	9606.ENSP00000343890	0.681	Ceramide-1-phosphate transfer protein
9	9606.ENSP00000352438	0.642	Poly(rC)-binding protein 2
10	9606.ENSP00000380307	0.641	Junctophilin-4
11	9606.ENSP00000364490	0.628	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
12	9606.ENSP00000362760	0.616	Zinc finger and BTB domain-containing protein 26
13	9606.ENSP00000402394	0.613	Carbohydrate sulfotransferase 15
14	9606.ENSP00000368169	0.608	Segment polarity protein dishevelled homolog DVL-1
15	9606.ENSP00000380516	0.604	Homeobox-containing protein 1
16	9606.ENSP00000341815	0.600	Transcription factor SOX-18
17	9606.ENSP00000254942	0.576	Telomeric repeat-binding factor 2
18	9606.ENSP00000371475	0.531	TP53-binding protein 1
19	9606.ENSP00000297792	0.530	Lysine-specific histone demethylase 1B
20	9606.ENSP00000404658	0.519	Histone-lysine N-methyltransferase EZH1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0000976	0.991	transcription cis-regulatory region binding
GO:0042802	0.987	identical protein binding
GO:0042162	0.925	telomeric DNA binding
GO:0003691	0.893	double-stranded telomeric DNA binding
GO:0140110	0.815	transcription regulator activity
GO:0003700	0.748	DNA-binding transcription factor activity
GO:0000977	0.571	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0019222	0.980	regulation of metabolic process
GO:0009987	0.973	cellular process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0009889	0.967	regulation of biosynthetic process
GO:0019219	0.963	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.962	regulation of macromolecule biosynthetic process
GO:0031326	0.960	regulation of cellular biosynthetic process
GO:0051252	0.939	regulation of RNA metabolic process
GO:0048518	0.930	positive regulation of biological process
GO:1903506	0.927	regulation of nucleic acid-templated transcription
GO:0010468	0.918	regulation of gene expression
GO:0006355	0.904	regulation of DNA-templated transcription
GO:0044238	0.882	primary metabolic process
GO:0071704	0.867	organic substance metabolic process
GO:0044237	0.866	cellular metabolic process
GO:0071840	0.842	cellular component organization or biogenesis
GO:0006807	0.840	nitrogen compound metabolic process
GO:0016043	0.813	cellular component organization
GO:0048519	0.796	negative regulation of biological process
GO:1901360	0.777	organic cyclic compound metabolic process
GO:0043170	0.765	macromolecule metabolic process
GO:0048522	0.729	positive regulation of cellular process
GO:0046483	0.720	heterocycle metabolic process
GO:0032200	0.706	telomere organization
GO:0010557	0.664	positive regulation of macromolecule biosynthetic process
GO:0048523	0.655	negative regulation of cellular process
GO:0031325	0.655	positive regulation of cellular metabolic process
GO:0045935	0.652	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.643	positive regulation of cellular biosynthetic process
GO:0034641	0.621	cellular nitrogen compound metabolic process
GO:0006725	0.618	cellular aromatic compound metabolic process
GO:0044260	0.585	cellular macromolecule metabolic process
GO:0090304	0.562	nucleic acid metabolic process
GO:0045893	0.509	positive regulation of DNA-templated transcription
GO:0000723	0.487	telomere maintenance
GO:0010605	0.434	negative regulation of macromolecule metabolic process
GO:0006357	0.427	regulation of transcription by RNA polymerase II
GO:0051172	0.406	negative regulation of nitrogen compound metabolic process
GO:0045934	0.398	negative regulation of nucleobase-containing compound metabolic process
GO:0010833	0.364	telomere maintenance via telomere lengthening
GO:0031327	0.335	negative regulation of cellular biosynthetic process
GO:0010558	0.334	negative regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0005654	0.993	nucleoplasm
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005694	0.890	chromosome
GO:0005737	0.722	cytoplasm
GO:0098687	0.587	chromosomal region
GO:0000781	0.485	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]