StarFunc result for job id P10092

User Input

>input (127 residues)
MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQM
KASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
RRRDLQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10092	1.000	1.000	1.191E-19	127	1.000	1.000	P10092.pdb.gz	CALCB_HUMAN Calcitonin gene-related peptide 2 OS=Homo sapiens OX=9606 GN=CALCB PE=1 SV=1
2	AFDB:P06881	0.408	0.405	7.025E-16	128	0.882	0.875	P06881.pdb.gz	CALCA_HUMAN Calcitonin gene-related peptide 1 OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=4
3	AFDB:P01256	0.459	0.456	1.651E-14	128	0.795	0.789	P01256.pdb.gz	CALCA_RAT Calcitonin gene-related peptide 1 OS=Rattus norvegicus OX=10116 GN=Calca PE=2 SV=1
4	AFDB:Q6DGJ9	0.347	0.349	6.760E-10	126	0.583	0.587	Q6DGJ9.pdb.gz	Q6DGJ9_DANRE Calca protein OS=Danio rerio OX=7955 GN=calc PE=2 SV=1
5	AFDB:P01258	0.358	0.326	1.470E-7	141	0.630	0.567	P01258.pdb.gz	CALC_HUMAN Calcitonin OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=3
6	AFDB:P01257	0.239	0.224	7.125E-7	136	0.520	0.485	P01257.pdb.gz	CALC_RAT Calcitonin OS=Rattus norvegicus OX=10116 GN=Calca PE=1 SV=1
7	AFDB:Q5H8A2	0.182	0.160	1.055	152	0.205	0.171	Q5H8A2.pdb.gz	NMS_RAT Neuromedin-S OS=Rattus norvegicus OX=10116 GN=Nms PE=1 SV=1
8	AFDB:P97297	0.183	0.132	1.405	184	0.189	0.130	P97297.pdb.gz	ADML_MOUSE Pro-adrenomedullin OS=Mus musculus OX=10090 GN=Adm PE=2 SV=2
9	AFDB:Q8C1F4	0.246	0.088	1.622	542	0.197	0.046	Q8C1F4.pdb.gz	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1
10	AFDB:P06307	0.244	0.267	2.495	115	0.134	0.148	P06307.pdb.gz	CCKN_HUMAN Cholecystokinin OS=Homo sapiens OX=9606 GN=CCK PE=1 SV=1
11	PDB:1xq8A	0.220	0.209	3.816	140	0.157	0.143	1xq8A.pdb.gz
12	PDB:6mj2A	0.187	0.025	5.870	1337	0.165	0.016	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
13	PDB:7abgv	0.229	0.243	6.776	119	0.087	0.092	7abgv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
14	PDB:4v8mBr	0.120	0.061	7.280	367	0.087	0.030	4v8mBr.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
15	PDB:7obqz	0.106	0.173	8.403	62	0.047	0.097	7obqz.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10092	1.54e-89	257	127	1.000	1.000	CALCB_HUMAN Calcitonin gene-related peptide 2 OS=Homo sapiens OX=9606 GN=CALCB PE=1 SV=1
2	P06881	1.87e-76	224	128	0.882	0.875	CALCA_HUMAN Calcitonin gene-related peptide 1 OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=4
3	P01256	1.30e-68	204	128	0.795	0.789	CALCA_RAT Calcitonin gene-related peptide 1 OS=Rattus norvegicus OX=10116 GN=Calca PE=2 SV=1
4	Q99JA0	7.94e-61	184	128	0.787	0.781	CALCA_MOUSE Calcitonin gene-related peptide 1 OS=Mus musculus OX=10090 GN=Calca PE=2 SV=1
5	Q6DGJ9	9.49e-43	139	126	0.575	0.579	Q6DGJ9_DANRE Calca protein OS=Danio rerio OX=7955 GN=calc PE=2 SV=1
6	P01258	5.05e-41	135	141	0.622	0.560	CALC_HUMAN Calcitonin OS=Homo sapiens OX=9606 GN=CALCA PE=1 SV=3
7	P70160	4.28e-26	97.1	136	0.543	0.507	CALC_MOUSE Calcitonin OS=Mus musculus OX=10090 GN=Calca PE=2 SV=1
8	P01257	2.43e-24	92.4	136	0.528	0.493	CALC_RAT Calcitonin OS=Rattus norvegicus OX=10116 GN=Calca PE=1 SV=1
9	P30880	6.96e-19	75.9	37	0.268	0.919	CALCA_PIG Calcitonin gene-related peptide OS=Sus scrofa OX=9823 GN=CALCA PE=1 SV=1
10	F1QIK6	1.89e-16	72.0	133	0.370	0.353	F1QIK6_DANRE Calcitonin gene-related peptide 2 isoform X1 OS=Danio rerio OX=7955 GN=calc PE=3 SV=1
11	P01263	1.99e-14	67.0	136	0.370	0.346	CALC1_ONCKE Calcitonin-1 OS=Oncorhynchus keta OX=8018 PE=1 SV=1
12	P12968	5.68e-10	54.3	93	0.244	0.333	IAPP_MOUSE Islet amyloid polypeptide OS=Mus musculus OX=10090 GN=Iapp PE=3 SV=1
13	P12969	2.74e-09	52.8	93	0.197	0.269	IAPP_RAT Islet amyloid polypeptide OS=Rattus norvegicus OX=10116 GN=Iapp PE=1 SV=1
14	P10997	1.44e-07	48.1	89	0.197	0.281	IAPP_HUMAN Islet amyloid polypeptide OS=Homo sapiens OX=9606 GN=IAPP PE=1 SV=1
15	D3Y4D2	0.001	36.6	37	0.134	0.459	D3Y4D2_PIG Islet amyloid polypeptide (Fragment) OS=Sus scrofa OX=9823 GN=IAPP PE=1 SV=1
16	F4IVR7	0.56	32.0	1770	0.150	0.011	MYO10_ARATH Myosin-10 OS=Arabidopsis thaliana OX=3702 GN=XI-D PE=3 SV=1
17	A0A384LCJ3	4.4	29.3	321	0.165	0.065	A0A384LCJ3_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53170 PE=1 SV=1
18	Q8GXR6	4.4	29.3	321	0.165	0.065	Q8GXR6_ARATH Sequence-specific DNA binding transcription factor OS=Arabidopsis thaliana OX=3702 GN=At3g58630 PE=1 SV=1
19	Q9UJX3	5.1	28.9	565	0.181	0.041	APC7_HUMAN Anaphase-promoting complex subunit 7 OS=Homo sapiens OX=9606 GN=ANAPC7 PE=1 SV=5
20	O14139	6.8	28.9	1388	0.181	0.017	HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrp3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00214 Calc_CGRP_IAPP	1e-42	157.2	Calcitonin / CGRP / IAPP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240652	0.964	Islet amyloid polypeptide
2	9606.ENSP00000352561	0.951	Calcitonin receptor
3	9606.ENSP00000386972	0.951	Calcitonin gene-related peptide type 1 receptor
4	9606.ENSP00000253796	0.950	Receptor activity-modifying protein 2
5	9606.ENSP00000254661	0.950	Receptor activity-modifying protein 1
6	9606.ENSP00000436607	0.950	ADM
7	9606.ENSP00000242249	0.943	Receptor activity-modifying protein 3
8	9606.ENSP00000331746	0.818	Calcitonin
9	9606.ENSP00000379087	0.792	ADM2
10	9606.ENSP00000393631	0.717	Putative adrenomedullin-5-like protein
11	9606.ENSP00000387662	0.675	Glucagon
12	9606.ENSP00000270631	0.647	Tuberoinfundibular peptide of 39 residues
13	9606.ENSP00000356213	0.647	VIP peptides
14	9606.ENSP00000282091	0.615	Parathyroid hormone
15	9606.ENSP00000462647	0.605	Pituitary adenylate cyclase-activating polypeptide
16	9606.ENSP00000381105	0.602	Neuropeptide S
17	9606.ENSP00000307599	0.592	Sodium channel protein type 11 subunit alpha
18	9606.ENSP00000176195	0.576	Secretin
19	9606.ENSP00000369017	0.559	Insulin-like 3
20	9606.ENSP00000369647	0.553	Vasopressin-neurophysin 2-copeptin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005184	0.998	neuropeptide hormone activity
GO:0001664	0.963	G protein-coupled receptor binding
GO:0031716	0.369	calcitonin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0023052	0.989	signaling
GO:0007154	0.989	cell communication
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.979	cellular response to stimulus
GO:0007165	0.950	signal transduction
GO:0055074	0.907	calcium ion homeostasis
GO:0007186	0.863	G protein-coupled receptor signaling pathway
GO:0032501	0.859	multicellular organismal process
GO:0048518	0.718	positive regulation of biological process
GO:0065008	0.639	regulation of biological quality
GO:0051239	0.638	regulation of multicellular organismal process
GO:0007188	0.601	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.591	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0006874	0.539	intracellular calcium ion homeostasis
GO:0048522	0.489	positive regulation of cellular process
GO:0048519	0.413	negative regulation of biological process
GO:0019222	0.385	regulation of metabolic process
GO:0009893	0.338	positive regulation of metabolic process
GO:0060255	0.337	regulation of macromolecule metabolic process
GO:0032502	0.310	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.809	intracellular anatomical structure
GO:0005737	0.742	cytoplasm
GO:0012505	0.404	endomembrane system
GO:0005615	0.377	extracellular space
GO:0120025	0.326	plasma membrane bounded cell projection
GO:0043231	0.324	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]