StarFunc result for job id P10109

User Input

>input (184 residues)
MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARAR
SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFE
DHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDV
GKTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10109	1.000	1.000	7.209E-34	184	1.000	1.000	P10109.pdb.gz	ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1
2	AFDB:P24483	0.667	0.654	1.946E-27	188	0.777	0.761	P24483.pdb.gz	ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fdx1 PE=2 SV=1
3	AFDB:P00257	0.681	0.674	4.869E-27	186	0.788	0.780	P00257.pdb.gz	ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus OX=9913 GN=FDX1 PE=1 SV=2
4	AFDB:A0A2R8QF75	0.627	0.682	5.931E-20	168	0.418	0.458	A0A2R8QF75.pdb.gz
5	PDB:7m8iA	0.567	0.183	9.363E-20	572	0.576	0.185	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
6	AFDB:E7F7J1	0.608	0.638	3.479E-19	175	0.424	0.446	E7F7J1.pdb.gz	E7F7J1_DANRE Adrenodoxin OS=Danio rerio OX=7955 GN=fdx1 PE=1 SV=1
7	AFDB:Q8SZA8	0.619	0.742	5.107E-18	152	0.440	0.533	Q8SZA8.pdb.gz	ADXH2_DROME Adrenodoxin-like protein 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Fdx2 PE=2 SV=1
8	AFDB:Q9M0V0	0.570	0.534	2.003E-16	197	0.359	0.335	Q9M0V0.pdb.gz	MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX1 PE=1 SV=1
9	AFDB:Q8S904	0.579	0.544	3.858E-16	197	0.332	0.310	Q8S904.pdb.gz	MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX2 PE=2 SV=1
10	AFDB:Q584K7	0.559	0.613	1.631E-15	167	0.304	0.335	Q584K7.pdb.gz	Q584K7_TRYB2 Adrenodoxin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.330 PE=4 SV=1
11	AFDB:Q9CPW2	0.584	0.616	5.663E-15	174	0.310	0.328	Q9CPW2.pdb.gz	FDX2_MOUSE Ferredoxin-2, mitochondrial OS=Mus musculus OX=10090 GN=Fdx2 PE=1 SV=1
12	PDB:6nblD	0.523	0.873	4.733E-10	107	0.179	0.308	6nblD.pdb.gz	Ligand and Redox Partner Binding Generates a New Conformational State in Cytochrome P450cam (CYP101A1).
13	PDB:1i7hA	0.496	0.798	2.281E-9	109	0.179	0.303	1i7hA.pdb.gz	Crystal structure of Escherichia coli Fdx, an adrenodoxin-type ferredoxin involved in the assembly of iron-sulfur clusters.
14	PDB:7aqqO	0.519	0.758	5.346E-9	122	0.196	0.295	7aqqO.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
15	PDB:5frtE	0.376	0.608	2.039E-4	105	0.141	0.248	5frtE.pdb.gz	Structure of Fesi Protein from Azotobacter Vinelandii
16	PDB:7xk3F	0.371	0.186	2.651E-4	408	0.130	0.059	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
17	PDB:7wffc	0.433	0.590	3.226E-4	128	0.120	0.172	7wffc.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
18	PDB:1czpA	0.354	0.619	8.621E-4	98	0.103	0.194	1czpA.pdb.gz	Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
19	PDB:5aukA	0.347	0.618	2.021E-3	96	0.114	0.219	5aukA.pdb.gz	X-ray Structure and Nuclear Magnetic Resonance Analysis of the Interaction Sites of the Ga-Substituted Cyanobacterial Ferredoxin
20	PDB:6khi1	0.352	0.618	3.891E-3	98	0.103	0.194	6khi1.pdb.gz	Structural basis for electron transport mechanism of complex I-like photosynthetic NAD(P)H dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10109	3.11e-133	372	184	1.000	1.000	ADX_HUMAN Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1
2	P00257	5.12e-96	278	186	0.783	0.774	ADX_BOVIN Adrenodoxin, mitochondrial OS=Bos taurus OX=9913 GN=FDX1 PE=1 SV=2
3	P24483	2.98e-87	256	188	0.783	0.766	ADX_RAT Adrenodoxin, mitochondrial OS=Rattus norvegicus OX=10116 GN=Fdx1 PE=2 SV=1
4	P46656	1.39e-84	249	188	0.777	0.761	ADX_MOUSE Adrenodoxin, mitochondrial OS=Mus musculus OX=10090 GN=Fdx1 PE=1 SV=1
5	E7F7J1	1.21e-56	178	175	0.418	0.440	E7F7J1_DANRE Adrenodoxin OS=Danio rerio OX=7955 GN=fdx1 PE=1 SV=1
6	A2BGD1	5.94e-46	150	168	0.370	0.405	A2BGD1_DANRE Ferredoxin 1b OS=Danio rerio OX=7955 GN=si:rp71-5c20.1 PE=1 SV=2
7	Q8SZA8	7.30e-45	147	152	0.435	0.526	ADXH2_DROME Adrenodoxin-like protein 2, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Fdx2 PE=2 SV=1
8	Q9M0V0	4.47e-30	110	197	0.283	0.264	MFDX1_ARATH Adrenodoxin-like protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX1 PE=1 SV=1
9	Q8S904	3.79e-29	108	197	0.293	0.274	MFDX2_ARATH Adrenodoxin-like protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MFDX2 PE=2 SV=1
10	Q12184	1.06e-25	99.0	172	0.283	0.302	ADRX_YEAST Adrenodoxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAH1 PE=1 SV=1
11	Q9CPW2	1.88e-22	90.5	174	0.332	0.351	FDX2_MOUSE Ferredoxin-2, mitochondrial OS=Mus musculus OX=10090 GN=Fdx2 PE=1 SV=1
12	P37193	4.17e-22	89.7	172	0.217	0.233	ADXH1_DROME Adrenodoxin-like protein 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Fdx1 PE=2 SV=3
13	Q6P4F2	1.56e-21	88.6	186	0.315	0.312	FDX2_HUMAN Ferredoxin-2, mitochondrial OS=Homo sapiens OX=9606 GN=FDX2 PE=1 SV=2
14	Q10361	2.00e-20	89.7	616	0.217	0.065	ETP1_SCHPO Electron transfer protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=etp1 PE=1 SV=2
15	Q584K7	6.88e-18	78.6	167	0.239	0.263	Q584K7_TRYB2 Adrenodoxin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.330 PE=4 SV=1
16	P0A9R4	3.84e-11	59.3	111	0.201	0.333	FER_ECOLI 2Fe-2S ferredoxin OS=Escherichia coli (strain K12) OX=83333 GN=fdx PE=1 SV=2
17	P00259	1.27e-08	52.8	107	0.179	0.308	PUTX_PSEPU Putidaredoxin OS=Pseudomonas putida OX=303 GN=camB PE=1 SV=3
18	D5IGG4	3.79e-06	45.8	109	0.163	0.275	CARAC_SPHSX Ferredoxin CarAc OS=Sphingomonas sp. OX=28214 GN=carAc PE=1 SV=1
19	Q9SRR8	3.49e-04	41.6	159	0.196	0.226	Q9SRR8_ARATH 2Fe-2S ferredoxin-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F21O3.19 PE=1 SV=1
20	Q13087	0.71	32.7	525	0.092	0.032	PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens OX=9606 GN=PDIA2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00111 Fer2	7e-05	34.0	2Fe-2S iron-sulfur cluster binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268053	0.999	Cholesterol side-chain cleavage enzyme, mitochondrial
2	9606.ENSP00000416515	0.999	NADPH:adrenodoxin oxidoreductase, mitochondrial
3	9606.ENSP00000310623	0.996	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
4	9606.ENSP00000363205	0.990	Cysteine desulfurase, mitochondrial
5	9606.ENSP00000307786	0.989	Cytochrome c
6	9606.ENSP00000285930	0.987	Aldose reductase
7	9606.ENSP00000366482	0.982	Frataxin, mitochondrial
8	9606.ENSP00000420026	0.981	LYR motif-containing protein 4
9	9606.ENSP00000216027	0.966	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
10	9606.ENSP00000276449	0.903	Steroidogenic acute regulatory protein, mitochondrial
11	9606.ENSP00000260970	0.885	Peptidyl-prolyl cis-trans isomerase G
12	9606.ENSP00000292427	0.873	Cytochrome P450 11B1, mitochondrial
13	9606.ENSP00000360569	0.852	Non-specific lipid-transfer protein
14	9606.ENSP00000365159	0.845	Iron-sulfur cluster assembly 1 homolog, mitochondrial
15	9606.ENSP00000258415	0.840	Sterol 26-hydroxylase, mitochondrial
16	9606.ENSP00000387219	0.840	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
17	9606.ENSP00000452007	0.832	Iron-sulfur cluster assembly 2 homolog, mitochondrial
18	9606.ENSP00000228606	0.831	25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
19	9606.ENSP00000377311	0.804	Ferredoxin-2, mitochondrial
20	9606.ENSP00000325822	0.784	Cytochrome P450 11B2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0009055	0.999	electron transfer activity
GO:0005515	0.997	protein binding
GO:0043167	0.978	ion binding
GO:0005506	0.974	iron ion binding
GO:0051540	0.927	metal cluster binding
GO:0051536	0.921	iron-sulfur cluster binding
GO:0051537	0.842	2 iron, 2 sulfur cluster binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0009987	0.984	cellular process
GO:0008202	0.979	steroid metabolic process
GO:0044237	0.907	cellular metabolic process
GO:0065007	0.892	biological regulation
GO:0009058	0.857	biosynthetic process
GO:0044281	0.856	small molecule metabolic process
GO:1901615	0.566	organic hydroxy compound metabolic process
GO:1901576	0.538	organic substance biosynthetic process
GO:0006066	0.465	alcohol metabolic process
GO:0065008	0.422	regulation of biological quality
GO:0050896	0.400	response to stimulus
GO:0006694	0.387	steroid biosynthetic process
GO:0042445	0.303	hormone metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.994	intracellular organelle lumen
GO:0005759	0.888	mitochondrial matrix
GO:0016020	0.810	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.999	Oxidoreductases.

[back to server]