StarFunc result for job id P10114

User Input

>input (183 residues)
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDL
ESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC
NIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JTW1	0.996	0.996	1.425E-39	183	0.995	0.995	A0A0G2JTW1.pdb.gz	A0A0G2JTW1_RAT Ras-related protein Rap-2 OS=Rattus norvegicus OX=10116 GN=Rap2a PE=3 SV=1
2	PDB:1kaoA	0.876	0.958	3.441E-30	167	0.907	0.994	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
3	AFDB:O17599	0.901	0.911	7.090E-30	181	0.672	0.680	O17599.pdb.gz	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
4	AFDB:P08645	0.911	0.906	1.745E-29	184	0.601	0.598	P08645.pdb.gz	RAP1_DROME Ras-related protein Rap1 OS=Drosophila melanogaster OX=7227 GN=Rap1 PE=2 SV=2
5	AFDB:Q18246	0.902	0.878	5.558E-29	188	0.623	0.606	Q18246.pdb.gz	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
6	AFDB:O96692	0.938	0.943	1.058E-28	182	0.672	0.676	O96692.pdb.gz	O96692_DROME small monomeric GTPase OS=Drosophila melanogaster OX=7227 GN=Rap2l PE=1 SV=1
7	AFDB:P03967	0.940	0.920	4.646E-28	187	0.492	0.481	P03967.pdb.gz	RASD_DICDI Ras-like protein rasD OS=Dictyostelium discoideum OX=44689 GN=rasD PE=1 SV=2
8	AFDB:B5X2X6	0.905	0.895	1.006E-27	185	0.601	0.595	B5X2X6.pdb.gz	B5X2X6_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
9	AFDB:A0A1D8PS50	0.899	0.665	1.072E-27	248	0.514	0.379	A0A1D8PS50.pdb.gz	A0A1D8PS50_CANAL Ras family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RSR1 PE=4 SV=1
10	AFDB:P18613	0.906	0.891	1.220E-27	186	0.563	0.554	P18613.pdb.gz	RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum OX=44689 GN=rapA PE=1 SV=1
11	AFDB:P15064	0.897	0.869	1.387E-27	189	0.497	0.481	P15064.pdb.gz	RASG_DICDI Ras-like protein rasG OS=Dictyostelium discoideum OX=44689 GN=rasG PE=1 SV=1
12	PDB:6kykC	0.881	0.953	3.879E-26	169	0.596	0.645	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
13	PDB:6zizA	0.895	0.963	2.384E-24	170	0.443	0.476	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
14	PDB:7sd0B	0.877	0.921	9.955E-23	174	0.410	0.431	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
15	PDB:6zqtA	0.879	0.929	1.224E-21	173	0.421	0.445	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.
16	PDB:2bovA	0.873	0.922	3.214E-21	173	0.415	0.439	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
17	PDB:5szjA	0.865	0.903	9.125E-20	175	0.290	0.303	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
18	PDB:2gf0B	0.813	0.853	4.275E-19	174	0.437	0.460	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
19	PDB:2zetA	0.869	0.878	7.628E-19	181	0.284	0.287	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
20	PDB:7e1tB	0.857	0.899	9.252E-19	174	0.339	0.356	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10114	1.93e-135	377	183	1.000	1.000	RAP2A_HUMAN Ras-related protein Rap-2a OS=Homo sapiens OX=9606 GN=RAP2A PE=1 SV=1
2	A0A0G2JTW1	6.69e-135	376	183	0.995	0.995	A0A0G2JTW1_RAT Ras-related protein Rap-2 OS=Rattus norvegicus OX=10116 GN=Rap2a PE=3 SV=1
3	Q80ZJ1	6.69e-135	376	183	0.995	0.995	RAP2A_MOUSE Ras-related protein Rap-2a OS=Mus musculus OX=10090 GN=Rap2a PE=1 SV=2
4	Q7ZX67	2.52e-134	374	183	0.989	0.989	Q7ZX67_XENLA small monomeric GTPase OS=Xenopus laevis OX=8355 GN=rap2a.S PE=1 SV=1
5	Q8BU31	4.11e-115	326	183	0.913	0.913	RAP2C_MOUSE Ras-related protein Rap-2c OS=Mus musculus OX=10090 GN=Rap2c PE=1 SV=1
6	Q9Y3L5	4.11e-115	326	183	0.913	0.913	RAP2C_HUMAN Ras-related protein Rap-2c OS=Homo sapiens OX=9606 GN=RAP2C PE=1 SV=1
7	P61225	1.83e-112	319	183	0.907	0.907	RAP2B_HUMAN Ras-related protein Rap-2b OS=Homo sapiens OX=9606 GN=RAP2B PE=1 SV=1
8	P61226	1.83e-112	319	183	0.907	0.907	RAP2B_MOUSE Ras-related protein Rap-2b OS=Mus musculus OX=10090 GN=Rap2b PE=1 SV=1
9	O17599	3.69e-82	243	181	0.689	0.696	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
10	O96692	1.06e-79	236	182	0.678	0.681	O96692_DROME small monomeric GTPase OS=Drosophila melanogaster OX=7227 GN=Rap2l PE=1 SV=1
11	B5XGC1	1.05e-78	234	184	0.623	0.620	B5XGC1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
12	Q18246	5.02e-78	232	188	0.617	0.601	RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans OX=6239 GN=rap-1 PE=3 SV=1
13	Q6IQP4	1.95e-77	231	185	0.601	0.595	Q6IQP4_DANRE small monomeric GTPase OS=Danio rerio OX=7955 GN=rap1a PE=1 SV=1
14	B5XFY1	2.67e-77	230	185	0.601	0.595	B5XFY1_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1
15	F1NSA8	3.08e-77	230	184	0.601	0.598	F1NSA8_CHICK small monomeric GTPase OS=Gallus gallus OX=9031 GN=RAP1A PE=1 SV=2
16	Q6TEN1	3.18e-77	230	184	0.612	0.609	RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio OX=7955 GN=rap1b PE=2 SV=1
17	P62834	3.33e-77	230	184	0.601	0.598	RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens OX=9606 GN=RAP1A PE=1 SV=1
18	P62835	3.33e-77	230	184	0.601	0.598	RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus OX=10090 GN=Rap1a PE=1 SV=1
19	P62836	3.33e-77	230	184	0.601	0.598	RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus OX=10116 GN=Rap1a PE=1 SV=1
20	B5X794	4.05e-77	230	185	0.607	0.600	B5X794_SALSA small monomeric GTPase OS=Salmo salar OX=8030 GN=RAP1B PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13479 AAA_24	4.6e+02	11.9	AAA domain
2	PF00025 Arf	2e-06	38.9	ADP-ribosylation factor family
3	PF02421 FeoB_N	8.5	17.4	Ferrous iron transport protein B
4	PF00009 GTP_EFTU	0.034	25.2	Elongation factor Tu GTP binding domain
5	PF03308 MeaB	4.7e+02	11.1	Methylmalonyl Co-A mutase-associated GTPase MeaB
6	PF01926 MMR_HSR1	0.49	21.9	50S ribosome-binding GTPase
7	PF16897 MMR_HSR1_Xtn	17	16.8	C-terminal region of MMR_HSR1 domain
8	PF00071 Ras	1.7e-53	192.0	Ras family
9	PF08477 Roc	1.3e-16	72.3	Ras of Complex, Roc, domain of DAPkinase
10	PF03193 RsgA_GTPase	0.00064	31.2	RsgA GTPase
11	PF00205 TPP_enzyme_M	10	17.3	Thiamine pyrophosphate enzyme, central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 59463.ENSMLUP00000009960

Rank	PPI partner	STRING score	Description
1	59463.ENSMLUP00000012126	0.969	RAB28, member RAS oncogene family
2	59463.ENSMLUP00000006636	0.897	Rap guanine nucleotide exchange factor (GEF) 2
3	59463.ENSMLUP00000002140	0.828	Uncharacterized protein
4	59463.ENSMLUP00000002654	0.823	Farnesyltransferase, CAAX box, alpha
5	59463.ENSMLUP00000010102	0.811	Rap guanine nucleotide exchange factor (GEF) 3
6	59463.ENSMLUP00000003872	0.808	Tuberous sclerosis 2
7	59463.ENSMLUP00000007942	0.797	PH domain and leucine rich repeat protein phosphatase 2
8	59463.ENSMLUP00000011050	0.777	Uncharacterized protein
9	59463.ENSMLUP00000015663	0.769	KRIT1, ankyrin repeat containing
10	59463.ENSMLUP00000004311	0.754	Rho guanine nucleotide exchange factor (GEF) 28
11	59463.ENSMLUP00000005172	0.727	Uncharacterized protein
12	59463.ENSMLUP00000021365	0.716	RUN domain containing 3B
13	59463.ENSMLUP00000006371	0.714	Rho guanine nucleotide exchange factor (GEF) 40
14	59463.ENSMLUP00000003258	0.706	Rho GTPase activating protein 6
15	59463.ENSMLUP00000007839	0.703	SUMO1/sentrin specific peptidase 7
16	59463.ENSMLUP00000001748	0.696	RUN domain containing 3A
17	59463.ENSMLUP00000005245	0.694	Mitogen-activated protein kinase kinase kinase kinase 4
18	59463.ENSMLUP00000006754	0.686	CCM2 like scaffolding protein
19	59463.ENSMLUP00000005096	0.683	Rap guanine nucleotide exchange factor (GEF) 4
20	59463.ENSMLUP00000022126	0.683	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043168	0.999	anion binding
GO:0017076	0.999	purine nucleotide binding
GO:0032553	0.999	ribonucleotide binding
GO:0019001	0.993	guanyl nucleotide binding
GO:0035639	0.987	purine ribonucleoside triphosphate binding
GO:0003924	0.976	GTPase activity
GO:0032561	0.975	guanyl ribonucleotide binding
GO:0005525	0.941	GTP binding
GO:0019003	0.854	GDP binding
GO:0098772	0.398	molecular function regulator activity
GO:0030234	0.317	enzyme regulator activity
GO:0019899	0.315	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0050896	0.985	response to stimulus
GO:0051174	0.977	regulation of phosphorus metabolic process
GO:0007165	0.971	signal transduction
GO:0001932	0.962	regulation of protein phosphorylation
GO:0031952	0.942	regulation of protein autophosphorylation
GO:0048518	0.941	positive regulation of biological process
GO:0040012	0.927	regulation of locomotion
GO:0035556	0.897	intracellular signal transduction
GO:0007264	0.879	small GTPase mediated signal transduction
GO:0010562	0.878	positive regulation of phosphorus metabolic process
GO:0045859	0.869	regulation of protein kinase activity
GO:0042327	0.857	positive regulation of phosphorylation
GO:0001934	0.847	positive regulation of protein phosphorylation
GO:0030336	0.830	negative regulation of cell migration
GO:0007265	0.742	Ras protein signal transduction
GO:0050730	0.684	regulation of peptidyl-tyrosine phosphorylation
GO:0048583	0.435	regulation of response to stimulus
GO:0023051	0.414	regulation of signaling
GO:0010646	0.411	regulation of cell communication
GO:0051179	0.395	localization
GO:0009966	0.390	regulation of signal transduction
GO:0071840	0.388	cellular component organization or biogenesis
GO:0032501	0.373	multicellular organismal process
GO:0032502	0.365	developmental process
GO:0016043	0.343	cellular component organization
GO:0048856	0.338	anatomical structure development
GO:0051128	0.324	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.997	vesicle
GO:0012505	0.994	endomembrane system
GO:0005829	0.987	cytosol
GO:0005886	0.966	plasma membrane
GO:0031410	0.965	cytoplasmic vesicle
GO:0030659	0.943	cytoplasmic vesicle membrane
GO:0055037	0.909	recycling endosome
GO:0098588	0.880	bounding membrane of organelle
GO:0055038	0.807	recycling endosome membrane
GO:0030054	0.688	cell junction
GO:0005576	0.679	extracellular region
GO:0043230	0.625	extracellular organelle
GO:0065010	0.617	extracellular membrane-bounded organelle
GO:1903561	0.592	extracellular vesicle
GO:0005615	0.580	extracellular space
GO:0070062	0.496	extracellular exosome
GO:0099503	0.414	secretory vesicle
GO:0045202	0.353	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.976	GTP + H2O = GDP + H(+) + phosphate

[back to server]