StarFunc result for job id P10147

User Input

>input (92 residues)
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16619	0.789	0.781	3.663E-16	93	0.957	0.946	P16619.pdb.gz	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
2	AFDB:P50229	0.730	0.730	2.638E-13	92	0.772	0.772	P50229.pdb.gz	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
3	AFDB:P10855	0.721	0.721	1.009E-12	92	0.750	0.750	P10855.pdb.gz	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
4	AFDB:P50230	0.694	0.694	5.660E-12	92	0.565	0.565	P50230.pdb.gz	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
5	AFDB:P14097	0.688	0.688	8.304E-12	92	0.587	0.587	P14097.pdb.gz	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
6	AFDB:P13236	0.688	0.688	1.218E-11	92	0.576	0.576	P13236.pdb.gz	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
7	AFDB:P55774	0.694	0.717	3.609E-11	89	0.609	0.629	P55774.pdb.gz	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
8	AFDB:P13501	0.669	0.676	1.003E-10	91	0.478	0.484	P13501.pdb.gz	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
9	PDB:7f1qR	0.658	0.176	5.878E-10	367	0.728	0.183	7f1qR.pdb.gz
10	AFDB:Q16627	0.665	0.658	6.394E-10	93	0.478	0.473	Q16627.pdb.gz	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
11	PDB:7f1tA	0.676	0.152	8.089E-10	423	0.707	0.154	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
12	AFDB:P50231	0.667	0.667	9.999E-10	92	0.424	0.424	P50231.pdb.gz	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
13	PDB:4zltF	0.623	0.911	1.856E-9	62	0.489	0.726	4zltF.pdb.gz
14	PDB:2q8tB	0.654	0.921	1.183E-8	65	0.359	0.508	2q8tB.pdb.gz
15	PDB:1humA	0.657	0.854	2.103E-8	69	0.511	0.681	1humA.pdb.gz
16	PDB:4mheA	0.603	0.792	8.041E-8	69	0.457	0.609	4mheA.pdb.gz
17	PDB:5yamA	0.630	0.811	9.740E-8	69	0.337	0.449	5yamA.pdb.gz
18	PDB:2ra4B	0.637	0.888	3.971E-7	65	0.272	0.385	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
19	PDB:1esrA	0.666	0.798	4.512E-7	76	0.283	0.342	1esrA.pdb.gz
20	PDB:6fgpB	0.567	0.744	1.254E-6	68	0.304	0.412	6fgpB.pdb.gz	The solution structure of monomeric CCL5 in complex with a doubly sulfated N-terminal segment of CCR5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10147	1.64e-63	188	92	1.000	1.000	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
2	P16619	1.76e-58	176	93	0.957	0.946	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
3	P50229	1.49e-46	145	92	0.772	0.772	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
4	P10855	7.41e-46	144	92	0.761	0.761	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
5	P13236	9.11e-36	118	92	0.576	0.576	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
6	P50230	1.80e-35	117	92	0.565	0.565	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
7	P55774	1.07e-34	115	89	0.609	0.629	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
8	Q8NHW4	1.39e-33	113	92	0.543	0.543	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
9	P14097	1.62e-32	110	92	0.511	0.511	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
10	Q16627	6.96e-28	98.6	93	0.478	0.473	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
11	P30882	3.74e-26	94.4	91	0.457	0.462	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
12	P50231	6.54e-25	91.3	92	0.467	0.467	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
13	P13501	2.50e-24	89.7	91	0.489	0.495	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
14	Q9I8E0	3.04e-22	84.3	89	0.413	0.427	Q9I8E0_CHICK Chemokine C-C motif ligand 4 OS=Gallus gallus OX=9031 GN=K203 PE=2 SV=1
15	Q4KS30	1.25e-21	82.8	89	0.402	0.416	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
16	F5HFL9	9.35e-21	80.5	94	0.402	0.394	F5HFL9_HHV8 K4 OS=Human herpesvirus 8 OX=37296 GN=K4 PE=1 SV=1
17	Q98157	9.35e-21	80.5	94	0.402	0.394	VMI2_HHV8P Viral macrophage inflammatory protein 2 OS=Human herpesvirus 8 type P (isolate GK18) OX=868565 GN=ORF K4 PE=1 SV=1
18	P14844	3.88e-20	80.5	148	0.446	0.277	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
19	P55773	2.02e-19	78.2	120	0.489	0.375	CCL23_HUMAN C-C motif chemokine 23 OS=Homo sapiens OX=9606 GN=CCL23 PE=1 SV=4
20	Q16663	1.21e-18	75.9	113	0.489	0.398	CCL15_HUMAN C-C motif chemokine 15 OS=Homo sapiens OX=9606 GN=CCL15 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	1.3e-18	78.2	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477908

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292303	0.999	C-C chemokine receptor type 5
2	9606.ENSP00000296140	0.999	C-C chemokine receptor type 1
3	9606.ENSP00000482259	0.998	C-C motif chemokine 4
4	9606.ENSP00000263341	0.996	Interleukin-1 beta
5	9606.ENSP00000398698	0.993	Tumor necrosis factor
6	9606.ENSP00000305651	0.992	C-X-C motif chemokine 10
7	9606.ENSP00000306512	0.989	Interleukin-8
8	9606.ENSP00000385675	0.989	Interleukin-6
9	9606.ENSP00000296871	0.988	Granulocyte-macrophage colony-stimulating factor
10	9606.ENSP00000412237	0.988	Interleukin-10
11	9606.ENSP00000379110	0.987	Growth-regulated alpha protein
12	9606.ENSP00000225474	0.986	Granulocyte colony-stimulating factor
13	9606.ENSP00000263339	0.984	Interleukin-1 alpha
14	9606.ENSP00000427279	0.983	C-X-C motif chemokine 2
15	9606.ENSP00000292301	0.977	C-C chemokine receptor type 2
16	9606.ENSP00000351671	0.977	C-C motif chemokine 20
17	9606.ENSP00000480558	0.976	C-C motif chemokine 3-like 1
18	9606.ENSP00000280357	0.972	Interleukin-18
19	9606.ENSP00000308815	0.971	C-C motif chemokine 19
20	9606.ENSP00000441600	0.962	C-C chemokine receptor type 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.846	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0009987	0.986	cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0006954	0.983	inflammatory response
GO:0050794	0.981	regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0009605	0.975	response to external stimulus
GO:0002376	0.974	immune system process
GO:0042221	0.969	response to chemical
GO:0048522	0.965	positive regulation of cellular process
GO:0019222	0.957	regulation of metabolic process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0048583	0.939	regulation of response to stimulus
GO:0002685	0.930	regulation of leukocyte migration
GO:0051239	0.928	regulation of multicellular organismal process
GO:0031349	0.908	positive regulation of defense response
GO:2000147	0.905	positive regulation of cell motility
GO:0030335	0.903	positive regulation of cell migration
GO:0048519	0.901	negative regulation of biological process
GO:0050900	0.894	leukocyte migration
GO:0002687	0.889	positive regulation of leukocyte migration
GO:0070887	0.888	cellular response to chemical stimulus
GO:0050727	0.884	regulation of inflammatory response
GO:0040011	0.882	locomotion
GO:0032501	0.873	multicellular organismal process
GO:0001819	0.870	positive regulation of cytokine production
GO:0071675	0.862	regulation of mononuclear cell migration
GO:0060326	0.860	cell chemotaxis
GO:0071677	0.844	positive regulation of mononuclear cell migration
GO:0032103	0.833	positive regulation of response to external stimulus
GO:0030595	0.823	leukocyte chemotaxis
GO:1903706	0.802	regulation of hemopoiesis
GO:0006955	0.798	immune response
GO:0007165	0.797	signal transduction
GO:1902533	0.793	positive regulation of intracellular signal transduction
GO:0045637	0.792	regulation of myeloid cell differentiation
GO:1902105	0.790	regulation of leukocyte differentiation
GO:0007267	0.764	cell-cell signaling
GO:0002761	0.758	regulation of myeloid leukocyte differentiation
GO:0050920	0.745	regulation of chemotaxis
GO:0002688	0.735	regulation of leukocyte chemotaxis
GO:1903555	0.732	regulation of tumor necrosis factor superfamily cytokine production
GO:0045670	0.729	regulation of osteoclast differentiation
GO:0048523	0.724	negative regulation of cellular process
GO:0002690	0.724	positive regulation of leukocyte chemotaxis
GO:0051707	0.712	response to other organism
GO:0042127	0.692	regulation of cell population proliferation
GO:0010033	0.689	response to organic substance
GO:0051924	0.670	regulation of calcium ion transport
GO:1903557	0.650	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0065008	0.635	regulation of biological quality
GO:0050850	0.625	positive regulation of calcium-mediated signaling
GO:2000403	0.625	positive regulation of lymphocyte migration
GO:0051702	0.600	biological process involved in interaction with symbiont
GO:0051851	0.544	modulation by host of symbiont process
GO:0001775	0.532	cell activation
GO:0098542	0.438	defense response to other organism
GO:1901700	0.426	response to oxygen-containing compound
GO:0051171	0.426	regulation of nitrogen compound metabolic process
GO:0031323	0.414	regulation of cellular metabolic process
GO:0080090	0.403	regulation of primary metabolic process
GO:0032502	0.395	developmental process
GO:0034097	0.390	response to cytokine
GO:0048856	0.384	anatomical structure development
GO:0031325	0.374	positive regulation of cellular metabolic process
GO:0071674	0.367	mononuclear cell migration
GO:0007166	0.365	cell surface receptor signaling pathway
GO:0051173	0.356	positive regulation of nitrogen compound metabolic process
GO:0071345	0.338	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005737	0.992	cytoplasm
GO:0005829	0.964	cytosol
GO:0005615	0.950	extracellular space
GO:0005886	0.523	plasma membrane
GO:0043231	0.354	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]