StarFunc result for job id P10176

User Input

>input (69 residues)
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10176	1.000	1.000	1.537E-11	69	1.000	1.000	P10176.pdb.gz	COX8A_HUMAN Cytochrome c oxidase subunit 8A, mitochondrial OS=Homo sapiens OX=9606 GN=COX8A PE=1 SV=2
2	AFDB:P80433	0.572	0.572	1.607E-8	69	0.667	0.667	P80433.pdb.gz	COX8A_RAT Cytochrome c oxidase subunit 8A, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox8a PE=1 SV=3
3	AFDB:P16221	0.503	0.497	6.110E-4	70	0.391	0.386	P16221.pdb.gz	COX8B_RAT Cytochrome c oxidase subunit 8B, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox8b PE=1 SV=3
4	AFDB:P48772	0.502	0.496	1.141E-3	70	0.377	0.371	P48772.pdb.gz	COX8B_MOUSE Cytochrome c oxidase subunit 8B, mitochondrial OS=Mus musculus OX=10090 GN=Cox8b PE=1 SV=1
5	AFDB:P10175	0.495	0.489	1.560E-3	70	0.391	0.386	P10175.pdb.gz	COX8B_BOVIN Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos taurus OX=9913 GN=COX8B PE=1 SV=3
6	PDB:2y69M	0.481	0.723	1.863E-2	43	0.261	0.419	2y69M.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
7	AFDB:Q7Z4L0	0.485	0.467	3.549E-2	72	0.362	0.347	Q7Z4L0.pdb.gz	COX8C_HUMAN Cytochrome c oxidase subunit 8C, mitochondrial OS=Homo sapiens OX=9606 GN=COX8C PE=2 SV=1
8	AFDB:A6H666	0.484	0.466	8.382E-2	72	0.362	0.347	A6H666.pdb.gz	COX8C_MOUSE Cytochrome c oxidase subunit 8C, mitochondrial OS=Mus musculus OX=10090 GN=Cox8c PE=3 SV=1
9	AFDB:Q9VP19	0.433	0.438	2.925E-1	68	0.232	0.235	Q9VP19.pdb.gz	Q9VP19_DROME Cytochrome c oxidase subunit 8, isoform A OS=Drosophila melanogaster OX=7227 GN=COX8 PE=2 SV=1
10	AFDB:P10092	0.381	0.235	2.411	127	0.203	0.110	P10092.pdb.gz	CALCB_HUMAN Calcitonin gene-related peptide 2 OS=Homo sapiens OX=9606 GN=CALCB PE=1 SV=1
11	AFDB:Q8L9W3	0.392	0.173	2.607	163	0.130	0.055	Q8L9W3.pdb.gz	ATL23_ARATH E3 ubiquitin-protein ligase ATL23 OS=Arabidopsis thaliana OX=3702 GN=ATL23 PE=1 SV=2
12	PDB:7r5jI0	0.382	0.175	4.415	173	0.130	0.052	7r5jI0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
13	PDB:6gejS	0.222	0.084	5.161	208	0.145	0.048	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:2h3aA	0.195	0.189	5.581	72	0.101	0.097	2h3aA.pdb.gz	Structural Basis for Nucleic Acid and Toxin Recognition of the Bacterial Antitoxin CcdA
15	PDB:6t9lN	0.144	0.126	5.581	82	0.087	0.073	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
16	PDB:6xwtA	0.289	0.276	8.247	74	0.145	0.135	6xwtA.pdb.gz
17	PDB:5xtcb	0.277	0.169	8.917	124	0.304	0.169	5xtcb.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
18	PDB:6qym0a	0.217	0.062	8.917	280	0.072	0.018	6qym0a.pdb.gz
19	PDB:6v3fA	0.347	0.026	8.917	1234	0.159	0.009	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
20	PDB:7o9kI	0.219	0.077	8.917	212	0.130	0.042	7o9kI.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10176	1.38e-43	136	69	1.000	1.000	COX8A_HUMAN Cytochrome c oxidase subunit 8A, mitochondrial OS=Homo sapiens OX=9606 GN=COX8A PE=1 SV=2
2	Q64445	4.94e-30	102	69	0.681	0.681	COX8A_MOUSE Cytochrome c oxidase subunit 8A, mitochondrial OS=Mus musculus OX=10090 GN=Cox8a PE=3 SV=1
3	P80433	7.36e-29	99.4	69	0.667	0.667	COX8A_RAT Cytochrome c oxidase subunit 8A, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox8a PE=1 SV=3
4	P16221	5.30e-12	57.0	70	0.362	0.357	COX8B_RAT Cytochrome c oxidase subunit 8B, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cox8b PE=1 SV=3
5	P48772	2.95e-11	55.1	70	0.348	0.343	COX8B_MOUSE Cytochrome c oxidase subunit 8B, mitochondrial OS=Mus musculus OX=10090 GN=Cox8b PE=1 SV=1
6	P10175	1.29e-09	50.8	70	0.348	0.343	COX8B_BOVIN Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos taurus OX=9913 GN=COX8B PE=1 SV=3
7	Q7Z4L0	4.22e-06	42.0	72	0.333	0.319	COX8C_HUMAN Cytochrome c oxidase subunit 8C, mitochondrial OS=Homo sapiens OX=9606 GN=COX8C PE=2 SV=1
8	A6H666	0.006	33.9	72	0.246	0.236	COX8C_MOUSE Cytochrome c oxidase subunit 8C, mitochondrial OS=Mus musculus OX=10090 GN=Cox8c PE=3 SV=1
9	Q5BN24	0.074	32.3	1363	0.290	0.015	Q5BN24_DANRE GLI family zinc finger 2b OS=Danio rerio OX=7955 GN=gli2b PE=2 SV=2
10	Q61602	0.41	30.0	1583	0.275	0.012	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
11	F1M9H1	3.1	27.7	1582	0.261	0.011	F1M9H1_RAT GLI family zinc finger 3 OS=Rattus norvegicus OX=10116 GN=Gli3 PE=3 SV=3
12	Q9ES38	4.0	27.3	690	0.217	0.022	S27A5_RAT Long-chain fatty acid transport protein 5 OS=Rattus norvegicus OX=10116 GN=Slc27a5 PE=1 SV=1
13	P10071	5.1	26.9	1580	0.261	0.011	GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=6
14	A0A2R8YGX0	6.1	26.9	1521	0.261	0.012	A0A2R8YGX0_HUMAN GLI family zinc finger 3 OS=Homo sapiens OX=9606 GN=GLI3 PE=1 SV=1
15	A0A8I6AWR3	7.5	26.6	1477	0.261	0.012	A0A8I6AWR3_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=1
16	F1M2B7	7.9	26.6	1544	0.261	0.012	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02285 COX8	1.7e-18	77.5	Cytochrome oxidase c subunit VIII

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321260

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258424	0.995	Cytochrome c oxidase subunit 5B, mitochondrial
2	9606.ENSP00000425759	0.995	Cytochrome c oxidase subunit 7C, mitochondrial
3	9606.ENSP00000246554	0.993	Cytochrome c oxidase subunit 6B1
4	9606.ENSP00000317780	0.992	Cytochrome c oxidase subunit 5A, mitochondrial
5	9606.ENSP00000229379	0.991	Cytochrome c oxidase subunit 6A1, mitochondrial
6	9606.ENSP00000457513	0.990	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
7	9606.ENSP00000428895	0.989	Cytochrome c oxidase subunit 6C
8	9606.ENSP00000339720	0.987	Cytochrome c oxidase subunit NDUFA4
9	9606.ENSP00000359098	0.986	Cytochrome c oxidase subunit 7A2, mitochondrial
10	9606.ENSP00000417656	0.986	Cytochrome c oxidase subunit 7B, mitochondrial
11	9606.ENSP00000354499	0.972	Cytochrome c oxidase subunit 1
12	9606.ENSP00000354876	0.971	Cytochrome c oxidase subunit 2
13	9606.ENSP00000354982	0.967	Cytochrome c oxidase subunit 3
14	9606.ENSP00000299166	0.944	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
15	9606.ENSP00000307786	0.934	Cytochrome c
16	9606.ENSP00000367938	0.897	Cytochrome c oxidase subunit 7A-related protein, mitochondrial
17	9606.ENSP00000340568	0.890	Cytochrome c oxidase subunit 8C, mitochondrial
18	9606.ENSP00000287490	0.888	Cytochrome c oxidase subunit 6A2, mitochondrial
19	9606.ENSP00000367939	0.881	Cytochrome b-c1 complex subunit 8
20	9606.ENSP00000365243	0.859	Cytochrome c oxidase subunit 4 isoform 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004129	1.000	cytochrome-c oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0006091	0.991	generation of precursor metabolites and energy
GO:0015980	0.474	energy derivation by oxidation of organic compounds
GO:0045333	0.352	cellular respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098803	0.998	respiratory chain complex
GO:0005746	0.997	mitochondrial respirasome
GO:0070069	0.995	cytochrome complex
GO:0098798	0.980	mitochondrial protein-containing complex
GO:0045277	0.958	respiratory chain complex IV
GO:0098800	0.945	inner mitochondrial membrane protein complex
GO:0005751	0.831	mitochondrial respiratory chain complex IV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11436	1.000	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	1.000	cytochrome-c oxidase.

[back to server]