StarFunc result for job id P10242

User Input

>input (640 residues)
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT
STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIK
YGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF
FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP
LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10242	1.000	1.000	5.662E-89	640	1.000	1.000	P10242.pdb.gz	MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=2
2	AFDB:F8W8G5	0.297	0.264	3.749E-81	726	1.000	0.882	F8W8G5.pdb.gz	F8W8G5_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
3	AFDB:P01103	0.346	0.346	2.269E-69	641	0.805	0.803	P01103.pdb.gz	MYB_CHICK Transcriptional activator Myb OS=Gallus gallus OX=9031 GN=MYB PE=1 SV=1
4	AFDB:A0A2R8RYE8	0.291	0.315	1.171E-48	590	0.544	0.590	A0A2R8RYE8.pdb.gz
5	AFDB:A0A2R8Q8E3	0.279	0.279	1.316E-48	641	0.555	0.554	A0A2R8Q8E3.pdb.gz
6	AFDB:F4JV48	0.260	0.169	4.404E-21	995	0.259	0.167	F4JV48.pdb.gz	F4JV48_ARATH Homeodomain-like protein OS=Arabidopsis thaliana OX=3702 GN=PC-MYB1 PE=1 SV=1
7	AFDB:Q94FL9	0.250	0.170	4.404E-21	961	0.259	0.173	Q94FL9.pdb.gz	MB3R4_ARATH Transcription factor MYB3R-4 OS=Arabidopsis thaliana OX=3702 GN=MYB3R4 PE=1 SV=1
8	AFDB:Q9FR97	0.166	0.191	2.555E-11	553	0.178	0.206	Q9FR97.pdb.gz	MYB65_ARATH Transcription factor MYB65 OS=Arabidopsis thaliana OX=3702 GN=MYB65 PE=2 SV=1
9	AFDB:F1QVS5	0.227	0.095	4.568E-11	1561	0.194	0.079	F1QVS5.pdb.gz	F1QVS5_DANRE Small nuclear RNA-activating complex, polypeptide 4 OS=Danio rerio OX=7955 GN=fi18h02 PE=4 SV=3
10	AFDB:S8GIB3	0.164	0.047	1.182E-9	2415	0.194	0.051	S8GIB3.pdb.gz	BFD1_TOXGM Bradyzoite-formation deficient protein 1 OS=Toxoplasma gondii (strain ATCC 50611 / Me49) OX=508771 GN=BFD1 PE=2 SV=2
11	PDB:5z56L	0.147	0.269	1.640E-6	342	0.061	0.114	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
12	PDB:5gm6c	0.140	0.214	3.921E-6	415	0.066	0.101	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:6qdvO	0.148	0.212	3.921E-6	441	0.089	0.129	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
14	PDB:7dcoL	0.140	0.204	7.010E-6	435	0.067	0.099	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:6id0L	0.156	0.208	7.429E-6	475	0.058	0.078	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:5yzgL	0.142	0.215	1.407E-5	419	0.077	0.117	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:6j6gc	0.151	0.219	1.994E-5	436	0.075	0.110	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
18	PDB:6iczL	0.139	0.195	3.364E-5	454	0.075	0.106	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
19	PDB:5mqfL	0.144	0.266	4.767E-5	336	0.089	0.170	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
20	PDB:5lj5O	0.138	0.302	5.354E-5	283	0.092	0.208	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WTI6	0.0	1182	660	0.884	0.858	A0A087WTI6_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
2	A0A0G2JV86	0.0	1154	614	0.867	0.904	A0A0G2JV86_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
3	A0A0G2K2A4	0.0	795	747	0.581	0.498	A0A0G2K2A4_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
4	A0A8I5ZUL7	0.0	1177	635	0.886	0.893	A0A8I5ZUL7_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=4 SV=1
5	A0A8I5ZY95	0.0	778	748	0.570	0.488	A0A8I5ZY95_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=4 SV=1
6	E9PLN0	0.0	1257	611	0.941	0.985	E9PLN0_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
7	F1QP24	0.0	617	641	0.572	0.571	F1QP24_DANRE Transcriptional activator Myb isoform 1 OS=Danio rerio OX=7955 GN=c-myb PE=4 SV=1
8	F1QP25	0.0	640	590	0.572	0.620	F1QP25_DANRE Transcriptional activator Myb isoform 2 OS=Danio rerio OX=7955 GN=c-myb PE=4 SV=1
9	F8W8G5	0.0	1187	726	0.884	0.780	F8W8G5_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
10	P01103	0.0	1108	641	0.827	0.825	MYB_CHICK Transcriptional activator Myb OS=Gallus gallus OX=9031 GN=MYB PE=1 SV=1
11	P06876	0.0	1210	636	0.905	0.910	MYB_MOUSE Transcriptional activator Myb OS=Mus musculus OX=10090 GN=Myb PE=1 SV=2
12	P10242	0.0	1337	640	1.000	1.000	MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=2
13	Q708E1	0.0	1258	612	0.941	0.984	Q708E1_HUMAN C-myb v-myb myeloblastosis viral oncogene homologue (avian), exon 1 and joined CDS OS=Homo sapiens OX=9606 GN=c-myb PE=1 SV=1
14	Q708E9	0.0	1337	640	1.000	1.000	Q708E9_HUMAN C-myb v-myb myeloblastosis viral oncogene homologue (avian), exon 1 and joined CDS OS=Homo sapiens OX=9606 GN=MYB PE=2 SV=1
15	P10243	3.79e-128	397	752	0.338	0.287	MYBA_HUMAN Myb-related protein A OS=Homo sapiens OX=9606 GN=MYBL1 PE=1 SV=2
16	P51960	1.87e-124	387	751	0.338	0.288	MYBA_MOUSE Myb-related protein A OS=Mus musculus OX=10090 GN=Mybl1 PE=1 SV=2
17	P10244	1.14e-84	281	700	0.206	0.189	MYBB_HUMAN Myb-related protein B OS=Homo sapiens OX=9606 GN=MYBL2 PE=1 SV=1
18	P48972	1.45e-83	279	704	0.206	0.188	MYBB_MOUSE Myb-related protein B OS=Mus musculus OX=10090 GN=Mybl2 PE=1 SV=1
19	D3ZLC6	5.77e-83	277	704	0.203	0.185	D3ZLC6_RAT MYB proto-oncogene like 2 OS=Rattus norvegicus OX=10116 GN=Mybl2 PE=4 SV=2
20	Q0JHU7	5.60e-71	242	587	0.169	0.184	MB3R2_ORYSJ Transcription factor MYB3R-2 OS=Oryza sativa subsp. japonica OX=39947 GN=MYB3R-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09316 Cmyb_C	8.6e-67	235.1	C-myb, C-terminal
2	PF07988 LMSTEN	3.8e-21	85.6	LMSTEN motif
3	PF00249 Myb_DNA-binding	9.6e-50	177.9	Myb-like DNA-binding domain
4	PF13921 Myb_DNA-bind_6	2.3e-37	138.3	Myb-like DNA-binding domain
5	PF15963 Myb_DNA-bind_7	1.5e-06	39.2	Myb DNA-binding like
6	PF12174 RST	3.3e+02	12.6	RCD1-SRO-TAF4 (RST) plant domain
7	PF16282 SANT_DAMP1_like	0.14	23.7	SANT/Myb-like domain of DAMP1
8	PF09111 SLIDE	0.24	22.8	SLIDE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000011033

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000013793	0.993	CREB binding protein
2	9555.ENSPANP00000013403	0.980	E1A binding protein p300
3	9555.ENSPANP00000014611	0.979	CCAAT/enhancer binding protein (C/EBP), beta
4	9555.ENSPANP00000011183	0.919	Lin-9 DREAM MuvB core complex component
5	9555.ENSPANP00000006784	0.913	GATA binding protein 1 (globin transcription factor 1)
6	9555.ENSPANP00000003777	0.909	Lin-54 DREAM MuvB core complex component
7	9555.ENSPANP00000000813	0.906	Lin-37 DREAM MuvB core complex component
8	9555.ENSPANP00000015233	0.905	MAF bZIP transcription factor
9	9555.ENSPANP00000009106	0.895	annotation not available
10	9555.ENSPANP00000004371	0.891	Lin-52 DREAM MuvB core complex component
11	9555.ENSPANP00000019804	0.881	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
12	9555.ENSPANP00000013553	0.875	Ubiquitin-conjugating enzyme E2I
13	9555.ENSPANP00000019079	0.857	Paired box 5
14	9555.ENSPANP00000003091	0.847	TAL bHLH transcription factor 1, erythroid differentiation factor
15	9555.ENSPANP00000000152	0.846	Cyclin D1
16	9555.ENSPANP00000000044	0.838	RB binding protein 7, chromatin remodeling factor
17	9555.ENSPANP00000018792	0.838	Retinoblastoma binding protein 4
18	9555.ENSPANP00000002734	0.837	F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase
19	9555.ENSPANP00000003261	0.830	Uncharacterized protein
20	9555.ENSPANP00000007556	0.822	Spi-1 proto-oncogene

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019904	0.387	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0050794	0.979	regulation of cellular process
GO:0048518	0.971	positive regulation of biological process
GO:0009987	0.968	cellular process
GO:0050896	0.938	response to stimulus
GO:0048522	0.936	positive regulation of cellular process
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:0009889	0.899	regulation of biosynthetic process
GO:0009891	0.877	positive regulation of biosynthetic process
GO:0050793	0.822	regulation of developmental process
GO:0032502	0.805	developmental process
GO:0032501	0.799	multicellular organismal process
GO:0051252	0.789	regulation of RNA metabolic process
GO:2001141	0.778	regulation of RNA biosynthetic process
GO:0045595	0.772	regulation of cell differentiation
GO:0006355	0.767	regulation of DNA-templated transcription
GO:0051239	0.741	regulation of multicellular organismal process
GO:0048856	0.731	anatomical structure development
GO:0031325	0.731	positive regulation of cellular metabolic process
GO:0048519	0.729	negative regulation of biological process
GO:0051173	0.709	positive regulation of nitrogen compound metabolic process
GO:0048523	0.688	negative regulation of cellular process
GO:2000026	0.682	regulation of multicellular organismal development
GO:0010557	0.662	positive regulation of macromolecule biosynthetic process
GO:0051254	0.662	positive regulation of RNA metabolic process
GO:0006357	0.654	regulation of transcription by RNA polymerase II
GO:0031328	0.652	positive regulation of cellular biosynthetic process
GO:1902680	0.628	positive regulation of RNA biosynthetic process
GO:0030154	0.612	cell differentiation
GO:1903508	0.611	positive regulation of nucleic acid-templated transcription
GO:0009892	0.607	negative regulation of metabolic process
GO:0045944	0.598	positive regulation of transcription by RNA polymerase II
GO:0010605	0.596	negative regulation of macromolecule metabolic process
GO:0031324	0.575	negative regulation of cellular metabolic process
GO:0009890	0.563	negative regulation of biosynthetic process
GO:0051253	0.545	negative regulation of RNA metabolic process
GO:1902679	0.536	negative regulation of RNA biosynthetic process
GO:0045892	0.523	negative regulation of DNA-templated transcription
GO:0051716	0.521	cellular response to stimulus
GO:0071840	0.518	cellular component organization or biogenesis
GO:0016043	0.510	cellular component organization
GO:0010628	0.471	positive regulation of gene expression
GO:0000122	0.457	negative regulation of transcription by RNA polymerase II
GO:0042221	0.426	response to chemical
GO:0007275	0.362	multicellular organism development
GO:0010629	0.352	negative regulation of gene expression
GO:0006950	0.334	response to stress
GO:0070887	0.311	cellular response to chemical stimulus
GO:0048731	0.307	system development
GO:0010033	0.302	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005829	0.994	cytosol
GO:0032991	0.943	protein-containing complex
GO:0005667	0.434	transcription regulator complex
GO:0090575	0.388	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]