StarFunc result for job id P10244

User Input

>input (700 residues)
MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASH
FPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ
CRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTI
KRKVDTGGFLSESKDCKPPVYLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEEN
SEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQEGSPPETSLPYKWVVEAANLL
IPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQASHQQQVLPPRQ
PSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL
SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCS
QKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPH
LEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMS
TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMS
SAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10244	1.000	1.000	3.292E-92	700	1.000	1.000	P10244.pdb.gz	MYBB_HUMAN Myb-related protein B OS=Homo sapiens OX=9606 GN=MYBL2 PE=1 SV=1
2	AFDB:D3ZLC6	0.377	0.375	2.541E-77	704	0.883	0.878	D3ZLC6.pdb.gz	D3ZLC6_RAT MYB proto-oncogene like 2 OS=Rattus norvegicus OX=10116 GN=Mybl2 PE=4 SV=2
3	AFDB:P01103	0.253	0.275	7.381E-32	641	0.369	0.402	P01103.pdb.gz	MYB_CHICK Transcriptional activator Myb OS=Gallus gallus OX=9031 GN=MYB PE=1 SV=1
4	AFDB:A0A2R8Q8E3	0.256	0.279	2.862E-28	641	0.321	0.351	A0A2R8Q8E3.pdb.gz
5	AFDB:F4JV48	0.229	0.162	5.612E-20	995	0.276	0.194	F4JV48.pdb.gz	F4JV48_ARATH Homeodomain-like protein OS=Arabidopsis thaliana OX=3702 GN=PC-MYB1 PE=1 SV=1
6	AFDB:Q94FL9	0.249	0.187	5.612E-20	961	0.231	0.169	Q94FL9.pdb.gz	MB3R4_ARATH Transcription factor MYB3R-4 OS=Arabidopsis thaliana OX=3702 GN=MYB3R4 PE=1 SV=1
7	AFDB:S8GIB3	0.153	0.047	1.397E-8	2415	0.196	0.057	S8GIB3.pdb.gz	BFD1_TOXGM Bradyzoite-formation deficient protein 1 OS=Toxoplasma gondii (strain ATCC 50611 / Me49) OX=508771 GN=BFD1 PE=2 SV=2
8	PDB:5z56L	0.137	0.271	1.153E-6	342	0.059	0.120	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
9	PDB:5yzgL	0.127	0.211	3.939E-6	419	0.073	0.122	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:5gm6c	0.137	0.227	5.207E-6	415	0.066	0.111	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
11	PDB:6id0L	0.140	0.202	9.101E-6	475	0.050	0.074	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
12	PDB:6qdvO	0.127	0.200	1.203E-5	441	0.071	0.113	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
13	PDB:6iczL	0.127	0.195	1.989E-5	454	0.073	0.112	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:7dcoL	0.137	0.218	2.780E-5	435	0.064	0.103	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:3jb9W	0.133	0.212	5.432E-5	426	0.063	0.103	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:6j6gc	0.139	0.220	8.030E-5	436	0.064	0.103	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
17	PDB:5gmkc	0.138	0.217	8.979E-5	436	0.047	0.076	5gmkc.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
18	AFDB:Q8BM75	0.068	0.046	6.503E-2	1188	0.147	0.087	Q8BM75.pdb.gz	ARI5B_MOUSE AT-rich interactive domain-containing protein 5B OS=Mus musculus OX=10090 GN=Arid5b PE=1 SV=3
19	AFDB:D3ZXN9	0.085	0.032	1.503E-1	2472	0.164	0.047	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
20	AFDB:Q8IFM2	0.071	0.030	2.936E-1	2380	0.141	0.042	Q8IFM2.pdb.gz	Q8IFM2_PLAF7 Surface-associated interspersed protein 4.2 (SURFIN 4.2) OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0424400 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZLC6	0.0	1207	704	0.883	0.878	D3ZLC6_RAT MYB proto-oncogene like 2 OS=Rattus norvegicus OX=10116 GN=Mybl2 PE=4 SV=2
2	P10244	0.0	1429	700	1.000	1.000	MYBB_HUMAN Myb-related protein B OS=Homo sapiens OX=9606 GN=MYBL2 PE=1 SV=1
3	P48972	0.0	1170	704	0.849	0.844	MYBB_MOUSE Myb-related protein B OS=Mus musculus OX=10090 GN=Mybl2 PE=1 SV=1
4	P10243	1.34e-147	449	752	0.434	0.404	MYBA_HUMAN Myb-related protein A OS=Homo sapiens OX=9606 GN=MYBL1 PE=1 SV=2
5	P51960	2.12e-145	444	751	0.433	0.403	MYBA_MOUSE Myb-related protein A OS=Mus musculus OX=10090 GN=Mybl1 PE=1 SV=2
6	P01103	1.52e-118	370	641	0.389	0.424	MYB_CHICK Transcriptional activator Myb OS=Gallus gallus OX=9031 GN=MYB PE=1 SV=1
7	P10242	7.97e-114	358	640	0.381	0.417	MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=2
8	Q708E9	7.97e-114	358	640	0.381	0.417	Q708E9_HUMAN C-myb v-myb myeloblastosis viral oncogene homologue (avian), exon 1 and joined CDS OS=Homo sapiens OX=9606 GN=MYB PE=2 SV=1
9	Q708E1	1.74e-109	346	612	0.343	0.392	Q708E1_HUMAN C-myb v-myb myeloblastosis viral oncogene homologue (avian), exon 1 and joined CDS OS=Homo sapiens OX=9606 GN=c-myb PE=1 SV=1
10	P06876	1.59e-85	284	636	0.216	0.237	MYB_MOUSE Transcriptional activator Myb OS=Mus musculus OX=10090 GN=Myb PE=1 SV=2
11	E9PLN0	3.23e-85	282	611	0.210	0.241	E9PLN0_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
12	A0A087WTI6	3.12e-84	281	660	0.210	0.223	A0A087WTI6_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
13	F8W8G5	5.96e-84	282	726	0.210	0.202	F8W8G5_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
14	A0A0G2JV86	8.48e-84	278	614	0.199	0.226	A0A0G2JV86_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
15	A0A0G2K2A4	1.18e-83	281	747	0.213	0.199	A0A0G2K2A4_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=1 SV=2
16	A0A8I5ZUL7	1.47e-83	278	635	0.207	0.228	A0A8I5ZUL7_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=4 SV=1
17	A0A8I5ZY95	3.62e-83	280	748	0.207	0.194	A0A8I5ZY95_RAT MYB proto-oncogene, transcription factor OS=Rattus norvegicus OX=10116 GN=Myb PE=4 SV=1
18	F1QP25	1.26e-82	275	590	0.174	0.207	F1QP25_DANRE Transcriptional activator Myb isoform 2 OS=Danio rerio OX=7955 GN=c-myb PE=4 SV=1
19	F1QP24	3.70e-82	275	641	0.174	0.190	F1QP24_DANRE Transcriptional activator Myb isoform 1 OS=Danio rerio OX=7955 GN=c-myb PE=4 SV=1
20	Q6R032	3.07e-65	227	548	0.141	0.181	MB3R5_ARATH Transcription factor MYB3R-5 OS=Arabidopsis thaliana OX=3702 GN=MYB3R5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09316 Cmyb_C	4.5e-57	203.6	C-myb, C-terminal
2	PF00249 Myb_DNA-binding	4.3e-45	163.0	Myb-like DNA-binding domain
3	PF13921 Myb_DNA-bind_6	6.5e-40	146.5	Myb-like DNA-binding domain
4	PF15963 Myb_DNA-bind_7	0.00014	33.0	Myb DNA-binding like
5	PF11626 Rap1_C	9.8e+02	11.3	TRF2-interacting telomeric protein/Rap1 - C terminal domain
6	PF16282 SANT_DAMP1_like	1.3e+02	14.2	SANT/Myb-like domain of DAMP1
7	PF09111 SLIDE	1.3	20.5	SLIDE
8	PF09548 Spore_III_AB	2.5e+02	13.2	Stage III sporulation protein AB (spore_III_AB)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329102	0.999	Protein lin-9 homolog
2	9606.ENSP00000301159	0.998	Protein lin-37 homolog
3	9606.ENSP00000341947	0.998	Protein lin-54 homolog
4	9606.ENSP00000342307	0.996	Forkhead box protein M1
5	9606.ENSP00000451812	0.996	Protein lin-52 homolog
6	9606.ENSP00000362768	0.995	Retinoblastoma-like protein 1
7	9606.ENSP00000368686	0.994	Transcription factor E2F4
8	9606.ENSP00000362592	0.988	Histone-binding protein RBBP4
9	9606.ENSP00000256442	0.984	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000266970	0.983	Cyclin-dependent kinase 2
11	9606.ENSP00000288207	0.980	G2/mitotic-specific cyclin-B2
12	9606.ENSP00000300093	0.978	Serine/threonine-protein kinase PLK1
13	9606.ENSP00000274026	0.977	Cyclin-A2
14	9606.ENSP00000398124	0.962	Transcription factor E2F5
15	9606.ENSP00000262133	0.955	Retinoblastoma-like protein 2
16	9606.ENSP00000255465	0.948	Cyclin-A1
17	9606.ENSP00000364519	0.948	Transcription factor Dp-1
18	9606.ENSP00000368924	0.940	Transcription factor AP-2-alpha
19	9606.ENSP00000362649	0.928	Histone deacetylase 1
20	9606.ENSP00000296930	0.924	Nucleophosmin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0080090	0.977	regulation of primary metabolic process
GO:0010468	0.977	regulation of gene expression
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:2001141	0.955	regulation of RNA biosynthetic process
GO:0006355	0.952	regulation of DNA-templated transcription
GO:0048522	0.905	positive regulation of cellular process
GO:0009987	0.887	cellular process
GO:0010604	0.789	positive regulation of macromolecule metabolic process
GO:0031325	0.762	positive regulation of cellular metabolic process
GO:0051173	0.761	positive regulation of nitrogen compound metabolic process
GO:0045935	0.739	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.734	positive regulation of biosynthetic process
GO:0006357	0.666	regulation of transcription by RNA polymerase II
GO:0010557	0.656	positive regulation of macromolecule biosynthetic process
GO:0071840	0.617	cellular component organization or biogenesis
GO:0031328	0.607	positive regulation of cellular biosynthetic process
GO:1902680	0.604	positive regulation of RNA biosynthetic process
GO:0016043	0.569	cellular component organization
GO:0045893	0.545	positive regulation of DNA-templated transcription
GO:0050896	0.520	response to stimulus
GO:0007049	0.429	cell cycle
GO:0022402	0.422	cell cycle process
GO:0051716	0.371	cellular response to stimulus
GO:0045944	0.341	positive regulation of transcription by RNA polymerase II
GO:0071704	0.328	organic substance metabolic process
GO:0000278	0.311	mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.955	protein-containing complex
GO:0005829	0.859	cytosol
GO:0140513	0.690	nuclear protein-containing complex
GO:0043232	0.416	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]