StarFunc result for job id P10253

User Input

>input (952 residues)
MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPV
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5kzwA	0.892	0.999	0.000	850	0.891	0.998	5kzwA.pdb.gz	The structure of human GAA: structural basis of Pompe disease
2	AFDB:A0A0J9YVE6	0.860	0.684	0.000	1200	0.351	0.278	A0A0J9YVE6.pdb.gz	A0A0J9YVE6_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
3	AFDB:F8VQM5	0.876	0.462	0.000	1818	0.402	0.211	F8VQM5.pdb.gz	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
4	AFDB:O43451	0.863	0.447	0.000	1857	0.416	0.213	O43451.pdb.gz	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
5	AFDB:P10253	1.000	1.000	0.000	952	1.000	1.000	P10253.pdb.gz	LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4
6	AFDB:P14410	0.876	0.460	0.000	1827	0.400	0.209	P14410.pdb.gz	SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens OX=9606 GN=SI PE=1 SV=6
7	AFDB:P23739	0.873	0.454	0.000	1841	0.401	0.207	P23739.pdb.gz	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
8	AFDB:P70699	0.957	0.956	0.000	953	0.803	0.802	P70699.pdb.gz	LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
9	AFDB:Q2M2H8	0.867	0.332	0.000	2515	0.390	0.148	Q2M2H8.pdb.gz	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
10	AFDB:Q9LYF8	0.803	0.847	2.331E-97	902	0.342	0.361	Q9LYF8.pdb.gz	Q9LYF8_ARATH AT5g11720/T22P22_110 OS=Arabidopsis thaliana OX=3702 GN=AGLU1 PE=1 SV=1
11	AFDB:Q9S7Y7	0.791	0.822	2.506E-95	915	0.336	0.350	Q9S7Y7.pdb.gz	XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=XYL1 PE=1 SV=1
12	PDB:5iefA	0.761	0.842	4.513E-77	858	0.267	0.296	5iefA.pdb.gz	Structures of mammalian ER alpha-glucosidase II capture the binding modes of broad-spectrum iminosugar antivirals.
13	PDB:5npbA	0.700	0.847	2.829E-61	780	0.190	0.232	5npbA.pdb.gz	1,6-Cyclophellitol Cyclosulfates: A New Class of Irreversible Glycosidase Inhibitor.
14	PDB:2f2hA	0.663	0.806	4.873E-49	773	0.158	0.194	2f2hA.pdb.gz	Expanding the Thioglycoligase Strategy to the Synthesis of alpha-linked Thioglycosides Allows Structural Investigation of the Parent Enzyme/Substrate Complex
15	PDB:5jovA	0.615	0.617	1.263E-46	949	0.181	0.181	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
16	PDB:5aedA	0.539	0.748	5.116E-37	674	0.129	0.182	5aedA.pdb.gz	Yihq is a Sulfoquinovosidase that Cleaves Sulfoquinovosyl Diacylglyceride Sulfolipids.
17	PDB:6druA	0.554	0.722	3.323E-36	718	0.142	0.188	6druA.pdb.gz	Crystal Structure of alpha-Xylosidase fromAspergillus nigerin Complex with a Hydrolyzed Xyloglucan Product and New Insights in Accurately Predicting Substrate Specificities of GH31 Family Glycosidases.
18	PDB:2xn2A	0.345	0.430	1.337E-14	729	0.091	0.119	2xn2A.pdb.gz	Crystal Structure of Alpha-Galactosidase from Lactobacillus Acidophilus Ncfm: Insight Into Tetramer Formation and Substrate Binding.
19	PDB:4fnsA	0.355	0.446	1.860E-14	718	0.095	0.125	4fnsA.pdb.gz	The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
20	PDB:5m1iA	0.312	0.501	8.757E-13	539	0.066	0.117	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YVE6	0.0	602	1200	0.355	0.282	A0A0J9YVE6_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
2	A0A0J9YVJ0	0.0	599	986	0.336	0.325	A0A0J9YVJ0_MOUSE Maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
3	A0A571BF69	0.0	602	3616	0.355	0.093	A0A571BF69_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
4	B5THE2	0.0	599	1827	0.356	0.186	B5THE2_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
5	B5THE3	0.0	626	1818	0.367	0.192	B5THE3_MOUSE Sucrase-isomaltase OS=Mus musculus OX=10090 GN=Sis PE=2 SV=1
6	F8VQM5	0.0	628	1818	0.372	0.195	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
7	O43451	0.0	634	2753	0.378	0.131	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
8	P10253	0.0	1962	952	1.000	1.000	LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4
9	P14410	0.0	642	1827	0.378	0.197	SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens OX=9606 GN=SI PE=1 SV=6
10	P23739	0.0	699	1841	0.394	0.204	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
11	P70699	0.0	1592	953	0.803	0.802	LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
12	Q2M2H8	0.0	627	2515	0.364	0.138	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
13	Q6P7A9	0.0	1604	953	0.816	0.815	LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus OX=10116 GN=Gaa PE=2 SV=1
14	Q9LYF8	0.0	568	902	0.326	0.344	Q9LYF8_ARATH AT5g11720/T22P22_110 OS=Arabidopsis thaliana OX=3702 GN=AGLU1 PE=1 SV=1
15	O04931	5.04e-177	539	913	0.337	0.352	AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris OX=161934 PE=1 SV=1
16	Q9S7Y7	4.67e-176	537	915	0.340	0.354	XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=XYL1 PE=1 SV=1
17	F4J6T7	3.65e-166	509	868	0.319	0.350	XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=XYL2 PE=5 SV=1
18	Q19004	6.58e-165	508	936	0.321	0.327	Q19004_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-1 PE=1 SV=2
19	Q21750	9.50e-165	509	955	0.348	0.347	Q21750_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-2 PE=1 SV=3
20	Q1HFV4	9.01e-150	467	874	0.307	0.334	Q1HFV4_EMEND Probable alpha/beta-glucosidase agdC OS=Emericella nidulans OX=162425 GN=AN0941-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17137 DUF5110	3.2e+02	13.0	Domain of unknown function (DUF5110)
2	PF13802 Gal_mutarotas_2	5.1e-08	44.4	Galactose mutarotase-like
3	PF01055 Glyco_hydro_31	3.2e-159	542.4	Glycosyl hydrolases family 31
4	PF16863 NtCtMGAM_N	4.1e-28	109.2	N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
5	PF00088 Trefoil	2.5e-12	57.7	Trefoil (P-type) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305692

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218516	0.977	Galactosidase alpha
2	9606.ENSP00000340736	0.942	Glycogenin-1
3	9606.ENSP00000264382	0.907	Sucrase-isomaltase, intestinal
4	9606.ENSP00000447378	0.907	Maltase-glucoamylase, intestinal
5	9606.ENSP00000447431	0.906	Probable maltase-glucoamylase 2
6	9606.ENSP00000481450	0.891	Pancreatic alpha-amylase
7	9606.ENSP00000354610	0.871	Amylase, alpha 2B
8	9606.ENSP00000294724	0.810	Glycogen debranching enzyme
9	9606.ENSP00000306920	0.734	Beta-galactosidase
10	9606.ENSP00000330484	0.732	Belongs to the glycosyl hydrolase 13 family
11	9606.ENSP00000335203	0.681	ATPase inhibitor, mitochondrial
12	9606.ENSP00000292432	0.676	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
13	9606.ENSP00000402103	0.669	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
14	9606.ENSP00000290573	0.664	Hexokinase-2
15	9606.ENSP00000346643	0.664	Putative hexokinase HKDC1
16	9606.ENSP00000365116	0.664	Chymotrypsin-C
17	9606.ENSP00000263519	0.657	Plasma membrane calcium-transporting ATPase 3
18	9606.ENSP00000408411	0.655	Lysosome-associated membrane glycoprotein 2
19	9606.ENSP00000353072	0.649	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
20	9606.ENSP00000421326	0.649	Calcium-transporting ATPase type 2C member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004558	1.000	alpha-1,4-glucosidase activity
GO:0005488	0.710	binding
GO:0005515	0.632	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0005975	0.992	carbohydrate metabolic process
GO:0044262	0.965	cellular carbohydrate metabolic process
GO:0016052	0.936	carbohydrate catabolic process
GO:0005976	0.926	polysaccharide metabolic process
GO:0005977	0.915	glycogen metabolic process
GO:0005980	0.889	glycogen catabolic process
GO:0032501	0.431	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0016020	0.997	membrane
GO:0005576	0.997	extracellular region
GO:0005764	0.996	lysosome
GO:0012505	0.994	endomembrane system
GO:0031982	0.993	vesicle
GO:0005775	0.992	vacuolar lumen
GO:0030141	0.962	secretory granule
GO:0071944	0.960	cell periphery
GO:0031090	0.954	organelle membrane
GO:0005886	0.915	plasma membrane
GO:0043202	0.914	lysosomal lumen
GO:0005615	0.904	extracellular space
GO:0043230	0.897	extracellular organelle
GO:0098588	0.882	bounding membrane of organelle
GO:1903561	0.861	extracellular vesicle
GO:0070062	0.839	extracellular exosome
GO:0042582	0.828	azurophil granule
GO:0098852	0.743	lytic vacuole membrane
GO:0005829	0.650	cytosol
GO:0030659	0.433	cytoplasmic vesicle membrane
GO:0101002	0.400	ficolin-1-rich granule
GO:0005765	0.376	lysosomal membrane
GO:0030667	0.366	secretory granule membrane
GO:0035578	0.354	azurophil granule lumen
GO:0031981	0.342	nuclear lumen
GO:0070820	0.311	tertiary granule
GO:0005654	0.300	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.20	1.000	alpha-glucosidase.

[back to server]