StarFunc result for job id P10275

User Input

>input (920 residues)
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ
SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD
LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC
KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG
KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ
SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP
YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL
ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN
DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL
TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA
KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR
MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII
SVQVPKILSGKVKPIYFHTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10275	1.000	1.000	0.000	920	1.000	1.000	P10275.pdb.gz	ANDR_HUMAN Androgen receptor OS=Homo sapiens OX=9606 GN=AR PE=1 SV=3
2	AFDB:P15207	0.519	0.529	4.686E-94	902	0.859	0.876	P15207.pdb.gz	ANDR_RAT Androgen receptor OS=Rattus norvegicus OX=10116 GN=Ar PE=1 SV=1
3	AFDB:A4GT83	0.400	0.422	1.054E-47	868	0.407	0.431	A4GT83.pdb.gz	A4GT83_DANRE Androgen receptor OS=Danio rerio OX=7955 GN=NR3C4 PE=2 SV=1
4	AFDB:P06401	0.272	0.269	1.374E-39	933	0.322	0.317	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
5	AFDB:Q00175	0.277	0.276	4.229E-39	926	0.326	0.324	Q00175.pdb.gz	PRGR_MOUSE Progesterone receptor OS=Mus musculus OX=10090 GN=Pgr PE=1 SV=2
6	AFDB:A6YIH7	0.280	0.267	1.222E-36	970	0.302	0.287	A6YIH7.pdb.gz	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
7	AFDB:B0ZBF6	0.314	0.295	4.536E-36	984	0.296	0.276	B0ZBF6.pdb.gz	B0ZBF6_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=4 SV=1
8	AFDB:C1KB84	0.283	0.265	4.536E-36	986	0.298	0.278	C1KB84.pdb.gz	C1KB84_CHICK Mineralocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C2 PE=2 SV=1
9	AFDB:G1K325	0.286	0.280	1.907E-27	942	0.266	0.260	G1K325.pdb.gz
10	PDB:7kw7F	0.235	0.801	1.378E-18	259	0.136	0.483	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
11	AFDB:P33244	0.195	0.176	3.021E-14	1027	0.199	0.178	P33244.pdb.gz	FTZF1_DROME Nuclear hormone receptor FTZ-F1 OS=Drosophila melanogaster OX=7227 GN=ftz-f1 PE=1 SV=2
12	PDB:3dzyA	0.197	0.559	1.513E-12	302	0.090	0.275	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
13	PDB:1g2nA	0.208	0.709	1.048E-7	246	0.064	0.240	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:6fx0A	0.212	0.721	1.674E-7	238	0.045	0.172	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
15	PDB:7vv6R	0.066	0.170	1.754E-1	271	0.037	0.125	7vv6R.pdb.gz	Structure, function and pharmacology of human itch receptor complexes.
16	PDB:6ibbA	0.065	0.146	4.271E-1	301	0.017	0.053	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
17	PDB:7f61A	0.072	0.162	4.476E-1	301	0.030	0.093	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
18	PDB:7o3vI	0.063	0.204	6.822E-1	193	0.029	0.140	7o3vI.pdb.gz
19	PDB:5khrA	0.073	0.059	7.492E-1	1391	0.036	0.024	5khrA.pdb.gz
20	PDB:1ekuB	0.054	0.148	8.228E-1	254	0.032	0.114	1ekuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4GT83	0.0	599	868	0.307	0.325	A4GT83_DANRE Androgen receptor OS=Danio rerio OX=7955 GN=NR3C4 PE=2 SV=1
2	F5GZG9	0.0	1463	734	0.787	0.986	F5GZG9_HUMAN Androgen receptor OS=Homo sapiens OX=9606 GN=AR PE=1 SV=1
3	G1NEJ8	0.0	739	374	0.366	0.901	G1NEJ8_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 GN=AR PE=3 SV=2
4	O93244	0.0	594	854	0.312	0.336	O93244_ONCMY Androgen receptor alpha OS=Oncorhynchus mykiss OX=8022 GN=AR-alpha PE=2 SV=1
5	P10275	0.0	1890	920	1.000	1.000	ANDR_HUMAN Androgen receptor OS=Homo sapiens OX=9606 GN=AR PE=1 SV=3
6	P15207	0.0	1430	902	0.863	0.880	ANDR_RAT Androgen receptor OS=Rattus norvegicus OX=10116 GN=Ar PE=1 SV=1
7	P19091	0.0	1434	899	0.858	0.878	ANDR_MOUSE Androgen receptor OS=Mus musculus OX=10090 GN=Ar PE=1 SV=1
8	Q2VP86	0.0	798	684	0.415	0.558	Q2VP86_TAEGU Androgen receptor OS=Taeniopygia guttata OX=59729 PE=2 SV=1
9	Q689Y8	0.0	670	343	0.333	0.892	Q689Y8_COTJA Androgen receptor (Fragment) OS=Coturnix japonica OX=93934 GN=AR PE=2 SV=1
10	Q7T1K4	0.0	739	777	0.468	0.555	ANDR_LITCT Androgen receptor OS=Lithobates catesbeianus OX=8400 GN=ar PE=2 SV=1
11	Q9I8F5	0.0	602	839	0.312	0.342	Q9I8F5_PIMPR Androgen receptor OS=Pimephales promelas OX=90988 PE=2 SV=2
12	Q690N0	8.21e-151	455	482	0.223	0.425	Q690N0_BOVIN Progesterone receptor (Fragment) OS=Bos taurus OX=9913 GN=PGR PE=2 SV=1
13	Q9GLW0	4.76e-148	464	939	0.222	0.217	PRGR_CANLF Progesterone receptor OS=Canis lupus familiaris OX=9615 GN=PGR PE=2 SV=1
14	P06401	5.48e-148	463	933	0.223	0.220	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
15	F1SV76	5.75e-148	463	934	0.222	0.218	F1SV76_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=3 SV=3
16	D0EWS6	6.59e-148	463	934	0.222	0.218	D0EWS6_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=2 SV=1
17	P07812	9.28e-148	458	786	0.227	0.266	PRGR_CHICK Progesterone receptor OS=Gallus gallus OX=9031 GN=PGR PE=1 SV=1
18	Q63449	3.09e-147	461	923	0.227	0.226	PRGR_RAT Progesterone receptor OS=Rattus norvegicus OX=10116 GN=Pgr PE=2 SV=1
19	Q00175	5.57e-146	458	926	0.226	0.225	PRGR_MOUSE Progesterone receptor OS=Mus musculus OX=10090 GN=Pgr PE=1 SV=2
20	C9V3N7	6.63e-137	424	617	0.210	0.313	C9V3N7_DANRE Nuclear progesterone receptor Pgr OS=Danio rerio OX=7955 GN=pr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02166 Androgen_recep	3.1e-246	829.6	Androgen receptor
2	PF00104 Hormone_recep	5.7e-28	109.5	Ligand-binding domain of nuclear hormone receptor
3	PF08297 U3_snoRNA_assoc	6.3e+02	12.5	U3 snoRNA associated
4	PF00105 zf-C4	1.3e-23	94.6	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363822

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250448	0.999	Hepatocyte nuclear factor 3-alpha
2	9606.ENSP00000301396	0.999	Proline-, glutamic acid- and leucine-rich protein 1
3	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
4	9606.ENSP00000344456	0.999	Catenin beta-1
5	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
7	9606.ENSP00000399968	0.999	Nuclear receptor coactivator 2
8	9606.ENSP00000463027	0.999	Nuclear receptor coactivator 4
9	9606.ENSP00000227507	0.998	G1/S-specific cyclin-D1
10	9606.ENSP00000258149	0.998	E3 ubiquitin-protein ligase Mdm2
11	9606.ENSP00000268712	0.998	Nuclear receptor corepressor 1
12	9606.ENSP00000314151	0.998	Prostate-specific antigen
13	9606.ENSP00000332973	0.998	Mothers against decapentaplegic homolog 3
14	9606.ENSP00000340330	0.998	Histone acetyltransferase KAT5
15	9606.ENSP00000383042	0.998	Lysine-specific histone demethylase 1A
16	9606.ENSP00000384018	0.998	Nuclear receptor corepressor 2
17	9606.ENSP00000428056	0.998	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000263253	0.997	Histone acetyltransferase p300
19	9606.ENSP00000320147	0.996	Histone-lysine N-methyltransferase EZH2
20	9606.ENSP00000264657	0.995	Signal transducer and activator of transcription 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0008134	1.000	transcription factor binding
GO:0004879	0.999	nuclear receptor activity
GO:1990837	0.997	sequence-specific double-stranded DNA binding
GO:0001216	0.996	DNA-binding transcription activator activity
GO:0005497	0.995	androgen binding
GO:0061629	0.957	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0005102	0.931	signaling receptor binding
GO:0003682	0.910	chromatin binding
GO:0001067	0.880	transcription regulatory region nucleic acid binding
GO:0000976	0.870	transcription cis-regulatory region binding
GO:0001221	0.868	transcription coregulator binding
GO:0001228	0.861	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001223	0.850	transcription coactivator binding
GO:0000977	0.776	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.765	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140296	0.754	general transcription initiation factor binding
GO:0001099	0.754	basal RNA polymerase II transcription machinery binding
GO:0001091	0.742	RNA polymerase II general transcription initiation factor binding
GO:0051117	0.733	ATPase binding
GO:0008013	0.707	beta-catenin binding
GO:0060090	0.705	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0050896	0.976	response to stimulus
GO:0048523	0.969	negative regulation of cellular process
GO:0045893	0.967	positive regulation of DNA-templated transcription
GO:0032501	0.953	multicellular organismal process
GO:0048856	0.950	anatomical structure development
GO:0051716	0.882	cellular response to stimulus
GO:0042221	0.881	response to chemical
GO:0010033	0.869	response to organic substance
GO:0007165	0.869	signal transduction
GO:0070887	0.835	cellular response to chemical stimulus
GO:0009719	0.731	response to endogenous stimulus
GO:0071495	0.711	cellular response to endogenous stimulus
GO:0030522	0.704	intracellular receptor signaling pathway
GO:0071310	0.702	cellular response to organic substance
GO:0043401	0.669	steroid hormone mediated signaling pathway
GO:1901700	0.659	response to oxygen-containing compound
GO:0030518	0.656	intracellular steroid hormone receptor signaling pathway
GO:0010605	0.635	negative regulation of macromolecule metabolic process
GO:0006357	0.628	regulation of transcription by RNA polymerase II
GO:0048513	0.620	animal organ development
GO:0048583	0.614	regulation of response to stimulus
GO:0051172	0.611	negative regulation of nitrogen compound metabolic process
GO:0023051	0.592	regulation of signaling
GO:0010646	0.592	regulation of cell communication
GO:0031324	0.591	negative regulation of cellular metabolic process
GO:1901654	0.532	response to ketone
GO:0009966	0.480	regulation of signal transduction
GO:0003006	0.453	developmental process involved in reproduction
GO:0007275	0.447	multicellular organism development
GO:1901701	0.440	cellular response to oxygen-containing compound
GO:0042127	0.435	regulation of cell population proliferation
GO:0008152	0.418	metabolic process
GO:0065009	0.410	regulation of molecular function
GO:0045892	0.407	negative regulation of DNA-templated transcription
GO:0045944	0.395	positive regulation of transcription by RNA polymerase II
GO:0048731	0.387	system development
GO:0071704	0.386	organic substance metabolic process
GO:0010941	0.352	regulation of cell death
GO:0043067	0.337	regulation of programmed cell death
GO:0044238	0.327	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005634	0.997	nucleus
GO:0005829	0.986	cytosol
GO:0005654	0.978	nucleoplasm
GO:0032991	0.406	protein-containing complex
GO:0016604	0.372	nuclear body
GO:0000785	0.369	chromatin
GO:0016607	0.352	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]